TCF15 Antibody

Images

 
Western Blot: TCF15 Antibody [NBP2-83630] - WB Suggested Anti-TCF15 Antibody Titration: 2.5ug/ml. Positive Control: Jurkat cell lysate

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TCF15 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of human TCF15. Peptide sequence: MAFALLRPVGAHVLYPDVRLLSEDEENRSESDASDQSFGCCEGPEAARRG The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
TCF15
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Alternate Names for TCF15 Antibody

  • transcription factor 15
  • bHLHa40
  • EC2
  • PARAXIS
  • transcription factor 15 (basic helix-loop-helix)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-56511
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, WB
NBP2-79843
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, PA, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
7268-CT
Species: Hu
Applications: BA
MAB2457
Species: Hu, Mu
Applications: CyTOF-ready, ICC, ICFlow, WB
NBP1-78984
Species: Hu, Mu
Applications: DB, ICC/IF, IHC, IHC-P, IP, WB
NB100-56510
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP1-81838
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP2-44245
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NB100-65805
Species: Gt, Hu, Mu, Pm, Sh
Applications: CyTOF-ready, DB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP2-37424
Species: Hu
Applications: ELISA, WB
PP-H4417-00
Species: Hu
Applications: DirELISA, IP, WB
NB500-327
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, IHC, IHC-P, In vitro, WB
MAB4609
Species: Mu
Applications: CyTOF-ready, Flow, ICC
423-F8
Species: Hu, Mu
Applications: BA
AF6989
Species: Mu
Applications: IHC

Publications for TCF15 Antibody (NBP2-83630) (0)

There are no publications for TCF15 Antibody (NBP2-83630).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TCF15 Antibody (NBP2-83630) (0)

There are no reviews for TCF15 Antibody (NBP2-83630). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for TCF15 Antibody (NBP2-83630) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TCF15 Products

Array NBP2-83630

Bioinformatics Tool for TCF15 Antibody (NBP2-83630)

Discover related pathways, diseases and genes to TCF15 Antibody (NBP2-83630). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TCF15 Antibody (NBP2-83630)

Discover more about diseases related to TCF15 Antibody (NBP2-83630).
 

Pathways for TCF15 Antibody (NBP2-83630)

View related products by pathway.

PTMs for TCF15 Antibody (NBP2-83630)

Learn more about PTMs related to TCF15 Antibody (NBP2-83630).

Blogs on TCF15

There are no specific blogs for TCF15, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TCF15 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TCF15