![Western Blot: TCF15 Antibody [NBP2-83630] - WB Suggested Anti-TCF15 Antibody Titration: 2.5ug/ml. Positive Control: Jurkat cell lysate](http://images.novusbio.com/fullsize2/TCF15-Antibody-Western-Blot-NBP2-83630-img0001.jpg "Western Blot: TCF15 Antibody [NBP2-83630] - WB Suggested Anti-TCF15 Antibody Titration: 2.5ug/ml. Positive Control: Jurkat cell lysate")
| Reactivity | HuSpecies Glossary |
| Applications | WB |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of human TCF15. Peptide sequence: MAFALLRPVGAHVLYPDVRLLSEDEENRSESDASDQSFGCCEGPEAARRG The peptide sequence for this immunogen was taken from within the described region. |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | TCF15 |
| Purity | Protein A purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, 2% Sucrose |
| Preservative | 0.09% Sodium Azide |
| Purity | Protein A purified |
![Immunocytochemistry/Immunofluorescence: MyoD Antibody (5.8A) [NB100-56511] - Cell Lines Tested: mouse skeletal muscle-derived primary cell population Test Sample Preparation: mouse skeletal muscle digested by collagenase type 2 System: Super Sensitive High Resolution Confocal Laser Microscope (LSM880 with Airyscan) Excitation Wavelength: 488nm Emission Filter: 562 nm. Image using the DyLight 488 form of this antibody. ICC/IF image submitted by a verified customer review.](http://images.novusbio.com/images2/MyoD-Antibody-(5.8A)-Immunocytochemistry-Immunofluorescence-NB100-56511-img0007.jpg)
![Immunocytochemistry/Immunofluorescence: MyoD Antibody (5.8A) [NB100-56511] - Human myoblasts were stained with MyoD1 antibody, diluted 1:200. ICC/IF image submitted by a verified customer review.](http://images.novusbio.com/images2/MyoD-Antibody-(5.8A)-Immunocytochemistry-Immunofluorescence-NB100-56511-img0008.jpg)
![Western Blot: MyoD Antibody (5.8A) [NB100-56511] - Insuline-like growth factor (IGF1) antagonized the effects of miR-106a-5p on myogenic differentiation in C2C12. All data were collected from C2C12 myotubes 5 d post differentiation. Western-blot analysis of myogenic regulatory factors (MyoD, MyoG, MyHC) in cells; (H) The statistical results of Figure 3G. Data were presented as mean +/- SEM. n = 3 per group. * p < 0.05, ** p < 0.01. Image collected and cropped by CiteAb from the following publication (https://www.mdpi.com/2073-4425/9/7/333/htm) licensed under a CC-BY licence. anti-MyoG (catalog# NB100-56510)](http://images.novusbio.com/images2/MyoD-Antibody-(5.8A)-Western-Blot-NB100-56511-img0009.jpg)
![Protein Array: HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free [NBP2-79843] - Analysis of Protein Array containing more than 19,000 full-length human proteins using HLA DQ/DR/DP Antibody (HLA-Pan/2967R). Z- and S- Score: The Z-score represents the strength of a signal that a monoclonal antibody (MAb) (in combination with a fluorescently-tagged anti-IgG secondary antibody) produces when binding to a particular protein on the HuProt(TM) array. Z-scores are described in units of standard deviations (SD's) above the mean value of all signals generated on that array. If targets on HuProt(TM) are arranged in descending order of the Z-score, the S-score is the difference (also in units of SD's) between the Z-score. S-score therefore represents the relative target specificity of a MAb to its intended target. A MAb is considered to specific to its intended target, if the MAb has an S-score of at least 2.5.](http://images.novusbio.com/images2/HLA-DQ-DR-DP-Antibody-(HLA-Pan-2967R)---Azide-and-BSA-Free-Protein-Array-NBP2-79843-img0001.jpg)
![Immunocytochemistry/Immunofluorescence: HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free [NBP2-79843] - Immunofluorescence staining of Raji cells using HLA DQ/DR/DP Antibody (HLA-Pan/2967R) followed by goat anti-rabbit IgG-CF488 (Green). Nuclei stained with RedDot (Red).](http://images.novusbio.com/images2/HLA-DQ-DR-DP-Antibody-(HLA-Pan-2967R)---Azide-and-BSA-Free-Immunocytochemistry-Immunofluorescence-NBP2-79843-img0002.jpg)
![Western Blot: HLA DQ/DR/DP Antibody (HLA-Pan/2967R) - Azide and BSA Free [NBP2-79843] - Western Blot Analysis of Ramos cell lysate using HLA DQ/DR/DP Antibody (HLA-Pan/2967R).](http://images.novusbio.com/images2/HLA-DQ-DR-DP-Antibody-(HLA-Pan-2967R)---Azide-and-BSA-Free-Western-Blot-NBP2-79843-img0003.jpg)
![Flow Cytometry: NOD2 Antibody (2D9) [NB100-524] - An intracellular stain was performed on Jurkat cells with NOD2 (2D9) antibody NB100-524APC (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes.](http://images.novusbio.com/images2/NOD2-Antibody-(2D9)-Flow-Cytometry-NB100-524-img0014.jpg)
![Flow Cytometry: NOD2 Antibody (2D9) [NB100-524] - An intracellular stain was performed on Jurkat cells with NOD2 (2D9) antibody NB100-524PE (blue) and a matched isotype control (orange). Cells were fixed with 4% PFA and then permeablized with 0.1% saponin. Cells were incubated in an antibody dilution of 2.5 ug/mL for 30 minutes.Both antibodies were conjugated to phycoerythrin.](http://images.novusbio.com/images2/NOD2-Antibody-(2D9)-Flow-Cytometry-NB100-524-img0015.jpg)
![Immunohistochemistry-Frozen: NOD2 Antibody (2D9) [NB100-524] - Overlay of NOD2-DyLight 488 (green) with phase contrast of murine colon. Image from verified customer review.](http://images.novusbio.com/images2/NOD2-Antibody-(2D9)-Immunohistochemistry-Frozen-NB100-524-img0016.jpg)
![Immunohistochemistry-Frozen: Myogenin Antibody (5FD) [NB100-56510] - Analysis of Myogenin in human alveolar rhabdomyosarcoma using NB100-56510 at 5 ug/mL.](http://images.novusbio.com/images2/Myogenin-Antibody-(5FD)-Immunohistochemistry-NB100-56510-img0008.jpg)
![Immunohistochemistry: Myogenin Antibody (5FD) [NB100-56510] - Human myocytes using NB100-56703 at 2.5 ug/mL. Hematoxylin-eosin counterstain.](http://images.novusbio.com/images2/Myogenin-Antibody-(5FD)-Immunohistochemistry-NB100-56510-img0009.jpg)
![Western Blot: Myogenin Antibody (5FD) [NB100-56510] - Analysis of Myogenin expression in various small-round cell tumor lines. The antibody strongly reacted with a band at ~34 kDa in alveolar rhobdomyosarcoma line (Rh30). Negative cell lines were PFSK-1, EB2, SK-N-SH, and SJSA-1.](http://images.novusbio.com/images2/Myogenin-Antibody-(5FD)-Western-Blot-NB100-56510-img0010.jpg)
![Western Blot: MYF-5 Antibody (OTI2G5) [NBP2-44245] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY MYF5 , (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-MYF5](http://images.novusbio.com/images2/MYF-5-Antibody-(OTI2G5)-Western-Blot-NBP2-44245-img0001.jpg)
![Immunohistochemistry-Paraffin: MYF-5 Antibody (OTI2G5) [NBP2-44245] - Human breast tissue within the normal limits using anti-MYF5 mouse monoclonal antibody. (Heat-induced epitope retrieval by 1 mM EDTA in 10mM Tris, pH8.5, 120C for 3min)](http://images.novusbio.com/images2/MYF-5-Antibody-(OTI2G5)-Immunohistochemistry-Paraffin-NBP2-44245-img0004.jpg)
![Immunohistochemistry-Paraffin: MYF-5 Antibody (OTI2G5) [NBP2-44245] - Carcinoma of Human kidney tissue using anti-MYF5 mouse monoclonal antibody. (Heat-induced epitope retrieval by 1 mM EDTA in 10mM Tris, pH8.5, 120C for 3min)](http://images.novusbio.com/images2/MYF-5-Antibody-(OTI2G5)-Immunohistochemistry-Paraffin-NBP2-44245-img0005.jpg)
![Flow Cytometry: CD81 Antibody (1D6) [NB100-65805] - A surface stain was performed on Jurkat Cells with CD81 Antibody (1D6) NB100-65805B and a matched isotype control. Both antibodies were conjugated to biotin. Cells were incubated in an antibody dilution of 1 ug/mL for 20 minutes at room temperature, followed by Streptavidin - R-Phycoerythrin Protein (2012-1000, Novus Biologicals).](http://images.novusbio.com/images2/CD81-Antibody-(1D6)-Flow-Cytometry-NB100-65805-img0013.jpg)
![Flow Cytometry: CD81 Antibody (1D6) [NB100-65805] - A surface stain was performed on Jurkat cells with CD81 Antibody [1D6] NB100-65805AF488 (blue) and a matched isotype control (orange). Cells were incubated in an antibody dilution of 5 ug/mL for 20 minutes at room temperature. Both antibodies were conjugated to Alexa Fluor 488.](http://images.novusbio.com/images2/CD81-Antibody-(1D6)-Flow-Cytometry-NB100-65805-img0014.jpg)
![Western Blot: CD81 Antibody (1D6) [NB100-65805] - Isolation and characterization of exosomes from cell culture supernatant and human blood. Immunoblot of exosomal markers CD81 (~30 kDa), CD63 (~55 kDa), and LAMP2B (~50 kDa) in exosomes (5 ug lysates) isolated from the serum of breast cancer patients and healthy control. Grp94 (~100 kDa) and beta-actin (~42 kDa) serve as a negative control and a loading control, respectively. Image collected and cropped by CiteAb from the following publication (http://www.nature.com/articles/srep36502), licensed under a CC-BY licence.](http://images.novusbio.com/images2/CD81-Antibody-(1D6)-Western-Blot-NB100-65805-img0015.jpg)
![ELISA: MESP2 Antibody (1B3F9) [NBP2-37424] - Red: Control Antigen (100ng); Purple: Antigen (10ng); Green: Antigen (50ng); Blue: Antigen (100ng);](http://images.novusbio.com/images2/MESP2-Antibody-(1B3F9)-ELISA-NBP2-37424-img0001.jpg)
![Western Blot: MESP2 Antibody (1B3F9) [NBP2-37424] - Analysis using MESP2 mAb against human MESP2 recombinant protein. (Expected MW is 31.4 kDa)](http://images.novusbio.com/images2/MESP2-Antibody-(1B3F9)-Western-Blot-NBP2-37424-img0002.jpg)
![Western Blot: MESP2 Antibody (1B3F9) [NBP2-37424] - Analysis using MESP2 mAb against HEK293 (1) and MESP2 (AA: 37-94)-hIgGFc transfected HEK293 (2) cell lysate.](http://images.novusbio.com/images2/MESP2-Antibody-(1B3F9)-Western-Blot-NBP2-37424-img0003.jpg)
![Flow Cytometry: CD9 Antibody (MEM-61) [NB500-327] - Staining of human peripheral blood with anti-CD9 (MEM-61) APC.](http://images.novusbio.com/images2/CD9-Antibody-(MEM-61)-Flow-Cytometry-NB500-327-img0006.jpg)
![Flow Cytometry: CD9 Antibody (MEM-61) [NB500-327] - Staining of human peripheral blood with anti-CD9 (MEM-61) PE.](http://images.novusbio.com/images2/CD9-Antibody-(MEM-61)-Flow-Cytometry-NB500-327-img0007.jpg)
![Flow Cytometry: CD9 Antibody (MEM-61) [NB500-327] - Staining of human peripheral blood with anti-CD9 (MEM-61) Alexa Fluor&#174; 647.](http://images.novusbio.com/images2/CD9-Antibody-(MEM-61)-Flow-Cytometry-NB500-327-img0008.jpg)
Secondary Antibodies |
Isotype Controls |
Diseases for TCF15 Antibody (NBP2-83630)Discover more about diseases related to TCF15 Antibody (NBP2-83630).
| Pathways for TCF15 Antibody (NBP2-83630)View related products by pathway.
|
PTMs for TCF15 Antibody (NBP2-83630)Learn more about PTMs related to TCF15 Antibody (NBP2-83630).
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | TCF15 |
![Western Blot: Desmoglein-3 Antibody (5H10) [NBP1-78984] - Analysis of Desmoglein 3 expression in HaCat cell lysate using NBP1-78984.](http://images.novusbio.com/images/Desmoglein-3-Antibody-(5H10)-Western-Blot-NBP1-78984-img0001.jpg)
![Western Blot: Desmoglein-3 Antibody (5H10) [NBP1-78984] - Colocalisation of Dsg3 with E-cadherin-catenin complex. Co-IPs demonstrated that both endogenous and exogenous Dsg3 interacted with the E-cadherin-catenin complex in A431 stable lines (the empty vector control (V) and hDsg3.myc (D3)) as well as in HaCaTs. When pulled down with antibodies against the myc tag or with a mouse Dsg3 Ab 5H10 and blotted for E-cadherin and beta-catenin, both proteins were detected in D3 and, to a lesser extent, in V. Conversely, when pulled down with E-cadherin Ab HECD-1 and blotted for Dsg3 or the myc tag and Pg, these proteins were detected in both V and D3 cells. Note that this result also was confirmed in HaCaTs (HaC) where Dsg3 was expressed endogenously (far right blot). Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0014211), licensed under a CC-BY licence.](http://images.novusbio.com/images2/Desmoglein-3-Antibody-(5H10)-Western-Blot-NBP1-78984-img0008.jpg)
![Immunocytochemistry/Immunofluorescence: Desmoglein-3 Antibody (5H10) [NBP1-78984] - The cultured primary mouse skin keratinocytes were stained at 1:150. The image shows the cytosolic staining. This image was submitted via customer review.](http://images.novusbio.com/images2/Desmoglein-3-Antibody-(5H10)-Immunocytochemistry-NBP1-78984-img0007.jpg)
![Western Blot: Glutaminyl-peptide Cyclotransferase/QPCT Antibody [NBP1-81838] - Analysis in human cell line SK-MEL-30.](http://images.novusbio.com/images2/Glutaminyl-peptide-Cyclotransferase-QPCT-Antibody-Western-Blot-NBP1-81838-img0006.jpg)
![Immunohistochemistry: Glutaminyl-peptide Cyclotransferase/QPCT Antibody [NBP1-81838] - Staining of human adrenal gland shows high expression.](http://images.novusbio.com/images2/Glutaminyl-peptide-Cyclotransferase-QPCT-Antibody-Immunohistochemistry-NBP1-81838-img0008.jpg)
![Immunohistochemistry-Paraffin: Glutaminyl-peptide Cyclotransferase/QPCT Antibody [NBP1-81838] - Staining of human liver shows low expression as expected.](http://images.novusbio.com/images2/Glutaminyl-peptide-Cyclotransferase-QPCT-Antibody-Immunohistochemistry-Paraffin-NBP1-81838-img0009.jpg)
![PXR/NR1I2 Antibody (H4417) [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "PXR/NR1I2 Antibody (H4417) [Unconjugated]")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](http://images.novusbio.com/images2/Goat-anti-Rabbit-IgG-(H+L)-Secondary-Antibody-[HRP]-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
