TCEB2 Antibody - Azide and BSA Free

Western Blot: TCEB2 Antibody [H00006923-B01P] - Analysis of TCEB2 expression in Jurkat.

Western Blot: TCEB2 Antibody [H00006923-B01P] - Analysis of TCEB2 expression in transfected 293T cell line by TCEB2 polyclonal antibody. Lane 1: TCEB2 transfected lysate(12.98 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

TCEB2 Antibody - Azide and BSA Free Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: TCEB2 (NP_009039.1, 1 a.a. - 118 a.a.) full-length human protein. MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGECGFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQAVQ
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: ELOB
• Purity: Protein G purified

Applications/Dilutions

• Dilutions:
  • Western Blot
• Application Notes: It has been used for WB and Functional.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein G purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for TCEB2 Antibody - Azide and BSA Free

• 18-kD subunit
• EloB
• Elongin 18 kDa subunit
• elongin-B
• RNA polymerase II transcription factor SIII p18 subunit
• RNA polymerase II transcription factor SIII subunit B
• SIII p18
• transcription elongation factor B (SIII), polypeptide 2 (18kD, elongin B)
• transcription elongation factor B (SIII), polypeptide 2 (18kDa, elongin B)
• transcription elongation factor B polypeptide 2

Background

TCEB2 encodes the protein elongin B, which is a subunit of the transcription factor B (SIII) complex. The SIII complex is composed of elongins A/A2, B and C. It activates elongation by RNA polymerase II by suppressing transient pausing of the polymerase at many sites within transcription units. Elongin A functions as the transcriptionally active component of the SIII complex, whereas elongins B and C are regulatory subunits. Elongin A2 is specifically expressed in the testis, and capable of forming a stable complex with elongins B and C. The von Hippel-Lindau tumor suppressor protein binds to elongins B and C, and thereby inhibits transcription elongation. Two alternatively spliced transcript variants encoding different isoforms have been described for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ELOB
• Uniprot:
  • NP_009039.1(Human)