TCEANC2 Antibody

Images

 
Western Blot: TCEANC2 Antibody [NBP2-13419] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: TCEANC2 Antibody [NBP2-13419] - Immunofluorescent staining of human cell line SK-MEL-30 shows localization to nucleoplasm & vesicles.
Immunohistochemistry-Paraffin: TCEANC2 Antibody [NBP2-13419] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TCEANC2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: TMLELPDQTKENLVEALQELKKKIPSREVLKSTRIGHTVNKMRKHSDSEV ASLAREVYTEWKTFTEKHSNRPSIEV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TCEANC2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TCEANC2 Protein (NBP2-13419PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (86%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TCEANC2 Antibody

  • C1orf83
  • chromosome 1 open reading frame 83
  • FLJ32112
  • FLJ39169
  • RP4-758J24.3
  • transcription elongation factor A (SII) N-terminal and central domaincontaining 2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86094
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37570
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC
NBP2-22356
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP2-29951
Species: Hu, Mu
Applications: WB, Flow, IHC-P
NBP2-57960
Species: Hu
Applications: ICC/IF
AF8355
Species: Hu
Applications: WB, IHC
H00005721-M02
Species: Hu
Applications: WB, ELISA, IHC-P, IP
NBP1-86471
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-46439
Species: Hu
Applications: WB, IHC
NBP1-88219
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-31703
Species: Hu
Applications: IHC, IHC-P
NBP2-03154
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-91780
Species: Hu, Mu, Rt
Applications: IHC, IHC-P
NBP1-81143
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-84022
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00010488-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NBP1-54378
Species: Hu
Applications: WB, ICC/IF, IHC
NBP2-03993
Species: Hu, Bv, Ca, Pm
Applications: WB, IHC, IHC-P
NBP2-16756
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-79280
Species: Hu, Mu
Applications: WB, IHC, IHC-P

Publications for TCEANC2 Antibody (NBP2-13419) (0)

There are no publications for TCEANC2 Antibody (NBP2-13419).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TCEANC2 Antibody (NBP2-13419) (0)

There are no reviews for TCEANC2 Antibody (NBP2-13419). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TCEANC2 Antibody (NBP2-13419) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TCEANC2 Products

Bioinformatics Tool for TCEANC2 Antibody (NBP2-13419)

Discover related pathways, diseases and genes to TCEANC2 Antibody (NBP2-13419). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on TCEANC2

There are no specific blogs for TCEANC2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TCEANC2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TCEANC2