TCEANC2 Antibody


Western Blot: TCEANC2 Antibody [NBP2-13419] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: TCEANC2 Antibody [NBP2-13419] - Immunofluorescent staining of human cell line SK-MEL-30 shows localization to nucleoplasm & vesicles.
Immunohistochemistry-Paraffin: TCEANC2 Antibody [NBP2-13419] - Staining of human cerebellum shows strong cytoplasmic positivity in Purkinje cells.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

TCEANC2 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: TMLELPDQTKENLVEALQELKKKIPSREVLKSTRIGHTVNKMRKHSDSEV ASLAREVYTEWKTFTEKHSNRPSIEV
Specificity of human TCEANC2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TCEANC2 Protein (NBP2-13419PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (86%)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for TCEANC2 Antibody

  • C1orf83
  • chromosome 1 open reading frame 83
  • FLJ32112
  • FLJ39169
  • RP4-758J24.3
  • transcription elongation factor A (SII) N-terminal and central domaincontaining 2


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Flow, IHC-P
Species: Hu
Applications: ICC/IF
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, ELISA, IHC-P, IP
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Bv, Ca, Pm
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Po, Bv, Eq, Fe, Pm, Rb
Applications: WB, Simple Western

Publications for TCEANC2 Antibody (NBP2-13419) (0)

There are no publications for TCEANC2 Antibody (NBP2-13419).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TCEANC2 Antibody (NBP2-13419) (0)

There are no reviews for TCEANC2 Antibody (NBP2-13419). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TCEANC2 Antibody (NBP2-13419) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional TCEANC2 Products

Bioinformatics Tool for TCEANC2 Antibody (NBP2-13419)

Discover related pathways, diseases and genes to TCEANC2 Antibody (NBP2-13419). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on TCEANC2

There are no specific blogs for TCEANC2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our TCEANC2 Antibody and receive a gift card or discount.


Gene Symbol TCEANC2