TBR1 Recombinant Protein Antigen

Images

 
There are currently no images for TBR1 Recombinant Protein Antigen (NBP2-62728PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

TBR1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TBR1

Source: E.coli

Amino Acid Sequence: LEHCLSPSIMLSKKFLNVSSSYPHSGGSELVLHDHPIISTTDNLERSSPLKKITRGMTNQSDTDNFPDSKDSPGDVQRSKLSPVLDGVSELRHSFD

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TBR1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-62728. Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related protocol, click here.
Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for TBR1 Recombinant Protein Antigen

  • MGC141978
  • T-box brain protein 1
  • T-box, brain, 1
  • TBR-1
  • T-brain-1
  • TES-56

Background

TBR1 - T-box, brain, 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. This product is guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB6166
Species: Hu
Applications: CyTOF-ready, ICC, ICFlow, WB
NB600-1081
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NB300-750
Species: Fi, Hu, Pm, Mu, Pm, Rt, Sh
Applications: ICC/IF, IHC, IP, WB
NBP1-85436
Species: Hu
Applications: IHC, IHC-P
NBP2-41181
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, Simple Western, WB
MAB3314
Species: Hu, Rt
Applications: IHC
NBP2-00594
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
NB100-2600
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-52123
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
NBP1-48272
Species: Hu, Pm, Mu, Rt, Ze
Applications: ICC/IF, IHC, IHC-P, IP, PEP-ELISA, WB
AF2746
Species: Hu, Mu
Applications: ICC, WB
H00055079-P01
Species: Hu
Applications: ELISA, AP, PA, WB
AF2567
Species: Mu
Applications: IHC, WB
NBP1-83619
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
AF566
Species: Mu, Rt
Applications: Block, CyTOF-ready, Flow, IHC, WB
NBP2-44501
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IF, IHC, IHC-P
DBD00
Species: Hu
Applications: ELISA
NBP1-88220
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-41266
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-43299
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB

Publications for TBR1 Recombinant Protein Antigen (NBP2-62728PEP) (0)

There are no publications for TBR1 Recombinant Protein Antigen (NBP2-62728PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TBR1 Recombinant Protein Antigen (NBP2-62728PEP) (0)

There are no reviews for TBR1 Recombinant Protein Antigen (NBP2-62728PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for TBR1 Recombinant Protein Antigen (NBP2-62728PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TBR1 Products

Bioinformatics Tool for TBR1 Recombinant Protein Antigen (NBP2-62728PEP)

Discover related pathways, diseases and genes to TBR1 Recombinant Protein Antigen (NBP2-62728PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TBR1 Recombinant Protein Antigen (NBP2-62728PEP)

Discover more about diseases related to TBR1 Recombinant Protein Antigen (NBP2-62728PEP).
 

Pathways for TBR1 Recombinant Protein Antigen (NBP2-62728PEP)

View related products by pathway.

PTMs for TBR1 Recombinant Protein Antigen (NBP2-62728PEP)

Learn more about PTMs related to TBR1 Recombinant Protein Antigen (NBP2-62728PEP).
 

Research Areas for TBR1 Recombinant Protein Antigen (NBP2-62728PEP)

Find related products by research area.

Blogs on TBR1.

Deriving neural precursor cells from human induced pluripotent stem cells
By Jennifer Sokolowski, MD, PhD.Human induced pluripotent stem cells (iPSCs) can be used to create models of human organ systems and are useful for a) ascertaining the mechanisms underlying pathological conditions...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TBR1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TBR1