TBK1 Recombinant Protein Antigen

Images

 
There are currently no images for TBK1 Recombinant Protein Antigen (NBP2-55777PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

TBK1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TBK1.

Source: E. coli

Amino Acid Sequence: TATIFHELVYKQTKIISSNQELIYEGRRLVLEPGRLAQHFPKTTEENPIFVVSREPLNTIGLIYEKISLPKVHPRYDLDGDASMAKAITGVV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TBK1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55777.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
28 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TBK1 Recombinant Protein Antigen

  • EC 2.7.11
  • EC 2.7.11.1
  • FLJ11330
  • FTDALS4
  • NAK serine/threonine-protein kinase TBK 1
  • NAK
  • NAKserine/threonine-protein kinase TBK1
  • NF-kappa-B-activating kinase
  • NFKB-Activating Kinase
  • T2K
  • TANK-binding kinase 1NF-kB-activating kinase
  • TBK 1
  • TBK1

Background

NFkappaB-activating kinase (NAK) also known as TANK binding kinase-1 (TBK1) or tumor necrosis factor receptor associated factor 2-associated kinase (T2K) is a serine/threonine protein that belongs to the IkB kinase (IKK) family (1). Similar to IKK alpha and beta (2), NAK induces IkB degradation and NF-kB activity. NAK is activated by phorbol ester tumour promoters and growth factors, whereas catalytically inactive NAK specifically inhibits activation of NF-kB by protein kinase C-epsilon (PKCepsilon). NAK specifically phosphorylates IkB alpha on Serine 36 and NFkB subunit RelA (p65) on Serine 536 (3). NAK is also known to interact with TANK, TRAF-2 and TRIF (4).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-67741
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB120-13810
Species: Mu, Po, Rt
Applications: IB, ICC/IF, IHC,  IHC-P, IP, KD, Simple Western, WB
NB100-80859
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
NB100-56583
Species: Hu, Rb, Rt
Applications: Flow, IHC,  IHC-P, KO, Simple Western, WB
NB100-56566
Species: Bv, Hu, Ma, Mu, Po, Rt
Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, In vitro, KD, KO, PAGE, Simple Western, WB
NBP2-24875
Species: Ca, Hu, Mu
Applications: BA, B/N, Flow-IC, Flow, ICC/IF, IHC,  IHC-P, WB
MAB3199
Species: Hu, Mu, Rt
Applications: ICC, WB
8499-IF
Species: Hu
Applications: BA
NB100-1207
Species: Hu, Mu
Applications: IHC,  IHC-P, PEP-ELISA, WB
NBP2-67634
Species: Hu, Mu, Rt, Ze
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, WB
NB100-56144
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NB100-56509
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, IB, ICC/IF, IHC,  IHC-P, IP, Simple Western, WB
NB100-56704
Species: Hu, Mu, Pm, Rt
Applications: ChIP, ChIP, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, Simple Western, WB
NB100-56176
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NBP2-29328
Species: Bv, Hu, Mu, Rt, Xp, Ye, Ze
Applications: BindInhib, B/N, ELISA, Flow, Func-Inh, IHC, In vitro, In vivo

Publications for TBK1 Recombinant Protein Antigen (NBP2-55777PEP) (0)

There are no publications for TBK1 Recombinant Protein Antigen (NBP2-55777PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TBK1 Recombinant Protein Antigen (NBP2-55777PEP) (0)

There are no reviews for TBK1 Recombinant Protein Antigen (NBP2-55777PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for TBK1 Recombinant Protein Antigen (NBP2-55777PEP). (Showing 1 - 6 of 6 FAQ).

  1. What is the exact sequence this TBK1 antibody recognizes?
    • The exact epitope of this TBK1 antibody is unknown because we do not perform epitope mapping. This TBK1 antibody was made against a synthetic peptide corresponding to aa 563-577 of human TBK1.
  2. I'm using NAX (TBK1 antibody) why is my band different from the predicted molecular weight?
    • While this TBK1 antibody is typically observed around 83 kDA variations including PTMs, relative charges and other experimental factors can affect where the band is observed.
  3. We are looking to use your TBK1 antibody in simple western but need a good loading control also validated in simple western, which would you recommend?
    • Our alpha tubulin loading control antibody (NB100-690) would be a good choice to use with the TBK1 antibody; it detects around 55 kDa and is validated in simple western.
  4. Is there a smaller size of your TBK1 antibody?
    • This TBK1 antibody is offered in a smaller 0.025 mg size.
  5. Are there any publications where this TBK1 antibody was used in western blot for mouse?
    • This TBK1 antibody was cited in a study looking at the relation between loss of TBK1 activity and increased susceptibility to LPS induced lethality. PMID 20651301
  6. Cant this TBK1 antibody be conjugated to PE for FLOW?
    • Although it has not been validated for flow we do offer this TBK1 antibody as a PE conjugate. If you would like to test in FLOW you may want to take advantage of our innovator's reward program.

Additional TBK1 Products

Research Areas for TBK1 Recombinant Protein Antigen (NBP2-55777PEP)

Find related products by research area.

Blogs on TBK1.

Autophagy Research Update: What a difference a year makes!
By Christina Towers, PhD Over the last two decades the field of autophagy has exploded! Innovative techniques, comprehensive analysis and disease-relevant models have yielded basic and clinical discoveries of conseque...  Read full blog post.

STING in Innate Immunity and Cancer: What’s the Buzz About?
STING (STimulator of INterferon Genes protein) acts as a sensor of cytosolic DNA. Bacteria/Virus or self-derived DNA in the cytosol activates the STING pathway and promotes the production of type I interferons (IFN-alpha and IFN-beta). STING also ...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TBK1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TBK1