TBK1 Recombinant Protein Antigen

Images

 
There are currently no images for TBK1 Protein (NBP2-13416PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

TBK1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TBK1.

Source: E.coli

Amino Acid Sequence: MLHLRKQLLSLTNQCFDIEEEVSKYQEYTNELQETLPQKMFTASSGIKHTMTPIYPSSNTLVEMTLGMKKLKEEMEGVVK

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TBK1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-13416.
Protein was purified by IMAC chromatography. The expected concentration is greater than 0.5 mg/ml. This product is produced on demand, estimated shipping date is 4 weeks after the order is placed.

For further blocking peptide related information and a protocol, click here.
Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for TBK1 Recombinant Protein Antigen

  • EC 2.7.11
  • EC 2.7.11.1
  • FLJ11330
  • NAK serine/threonine-protein kinase TBK 1
  • NAKserine/threonine-protein kinase TBK1
  • NF-kappa-B-activating kinase
  • T2K
  • TANK-binding kinase 1NF-kB-activating kinase
  • TBK 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-47812
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, Single Cell Western
NB120-13810
Species: Hu, Mu, Rt, Po
Applications: WB, Simple Western, IB, ICC/IF, IP
NBP2-22380
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56583
Species: Hu
Applications: WB, Flow, IHC-P
NB100-56566
Species: Hu, Mu, Rt
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, In vitro, CyTOF-ready, ELISA(Cap), Flow-CS, Flow-IC
NBP2-24875
Species: Hu, Mu, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP2-27419
Species: Hu, Pm
Applications: WB, IHC-P
MAB3199
Species: Hu, Mu, Rt
Applications: WB, ICC
NBP2-42073
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-77263
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB100-56144
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P, IP
NBP2-24683
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P, ICC, IF
NB100-56509
Species: Hu, Mu
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NB100-56704
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC-Fr, IHC-P, IP, Flow-IC
NB100-56176
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NBP2-29328
Species: Hu, Mu, Rt, Xp, Ye, Ze
Applications: ELISA
NBP2-13416PEP
Species: Hu
Applications: AC

Publications for TBK1 Protein (NBP2-13416PEP) (0)

There are no publications for TBK1 Protein (NBP2-13416PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TBK1 Protein (NBP2-13416PEP) (0)

There are no reviews for TBK1 Protein (NBP2-13416PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for TBK1 Protein (NBP2-13416PEP). (Showing 1 - 6 of 6 FAQ).

  1. What is the exact sequence this TBK1 antibody recognizes?
    • The exact epitope of this TBK1 antibody is unknown because we do not perform epitope mapping. This TBK1 antibody was made against a synthetic peptide corresponding to aa 563-577 of human TBK1.
  2. I'm using NAX (TBK1 antibody) why is my band different from the predicted molecular weight?
    • While this TBK1 antibody is typically observed around 83 kDA variations including PTMs, relative charges and other experimental factors can affect where the band is observed.
  3. We are looking to use your TBK1 antibody in simple western but need a good loading control also validated in simple western, which would you recommend?
    • Our alpha tubulin loading control antibody (NB100-690) would be a good choice to use with the TBK1 antibody; it detects around 55 kDa and is validated in simple western.
  4. Is there a smaller size of your TBK1 antibody?
    • This TBK1 antibody is offered in a smaller 0.025 mg size.
  5. Are there any publications where this TBK1 antibody was used in western blot for mouse?
    • This TBK1 antibody was cited in a study looking at the relation between loss of TBK1 activity and increased susceptibility to LPS induced lethality. PMID 20651301
  6. Cant this TBK1 antibody be conjugated to PE for FLOW?
    • Although it has not been validated for flow we do offer this TBK1 antibody as a PE conjugate. If you would like to test in FLOW you may want to take advantage of our innovator's reward program.

Additional Array Products

Bioinformatics Tool for TBK1 Protein (NBP2-13416PEP)

Discover related pathways, diseases and genes to TBK1 Protein (NBP2-13416PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TBK1 Protein (NBP2-13416PEP)

Discover more about diseases related to TBK1 Protein (NBP2-13416PEP).
 

Pathways for TBK1 Protein (NBP2-13416PEP)

View related products by pathway.

PTMs for TBK1 Protein (NBP2-13416PEP)

Learn more about PTMs related to TBK1 Protein (NBP2-13416PEP).
 

Research Areas for TBK1 Protein (NBP2-13416PEP)

Find related products by research area.

Blogs on TBK1.

STING in Innate Immunity and Cancer: What’s the Buzz About?
STING (STimulator of INterferon Genes protein) acts as a sensor of cytosolic DNA. Bacteria/Virus or self-derived DNA in the cytosol activates the STING pathway and promotes the production of type I interferons (IFN-alpha and IFN-beta). STING also...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TBK1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TBK1