TBC1D32 Antibody

Images

 
Western Blot: TBC1D32 Antibody [NBP1-90777] - Analysis in human cell line HDLM-2.
Immunocytochemistry/ Immunofluorescence: TBC1D32 Antibody [NBP1-90777] - Staining of human cell line U-251 MG shows localization to mitochondria. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: TBC1D32 Antibody [NBP1-90777] - Mouse normal lung tissue section. The section was pre-treated by heat mediated antigen retrieval with sodium citrate buffer (pH6). The section was incubated ...read more
Western Blot: TBC1D32 Antibody [NBP1-90777] - Analysis in human cell line HEK 293.
Immunohistochemistry-Paraffin: TBC1D32 Antibody [NBP1-90777] - Staining of human colon shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TBC1D32 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SVERNHVLVRINLVGGPLERILPPRLLEKSDNPYPWPMFSSYPLPNCYLSDITRNAGIKQDNDLDKLLLCLKISDKQTEWIENCQRQFCKMMKAKPDIISGEALIELLEKFVLHLTESPSECYFPSVEYTATDANVKNE
Specificity
Specificity of human C6orf170 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
C6ORF170
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Reviewed Applications
Read 1 Review rated 4
using
NBP1-90777 in the following applications:

Reactivity Notes

Reactivity reported in mouse normal lung tissue section from a verified customer reveiw.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TBC1D32 Antibody

  • bA301B7.2
  • bA57L9.1
  • BROMI
  • C6orf170
  • C6orf171
  • chromosome 6 open reading frame 170
  • dJ310J6.1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00003347-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-91214
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-54654
Species: Hu, Mu, Rt, Bv, Ca, Eq, GP
Applications: WB, IHC, IHC-P
AF3635
Species: Mu
Applications: WB, IHC
NB600-600
Species: Hu, Mu, Ca
Applications: WB, ChIP, ELISA, Flow, IB, IHC, IHC-P, Flow-IC
7460-F4/CF
Species: Hu
AF1107
Species: Mu
Applications: WB, IHC
NBP2-76871
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC, IP, ICC
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-83239
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-90777
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for TBC1D32 Antibody (NBP1-90777) (0)

There are no publications for TBC1D32 Antibody (NBP1-90777).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for TBC1D32 Antibody (NBP1-90777) (1) 41

Average Rating: 4
(Based on 1 review)
We have 1 review tested in 1 species: Human and Mouse.

Reviews using NBP1-90777:
Filter by Applications
IHC-P
(1)
All Applications
Filter by Species
Human and Mouse
(1)
All Species
Images Ratings Applications Species Date Details
Immunohistochemistry-Paraffin TBC1D32 NBP1-90777
Enlarge
reviewed by:
Mei Deng
IHC-P Human and Mouse 02/24/2017
View

Summary

ApplicationImmunohistochemistry-Paraffin
Sample TestedSalivary gland tissue,Adult lung
SpeciesHuman and Mouse

Comments

CommentsNice staining of IHC-P on human and mouse tissue with this antibody at a dilution 1:50. The section was pre-treated by heat mediated antigen retrieval with sodium citrate buffer (pH6).

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TBC1D32 Antibody (NBP1-90777) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional TBC1D32 Products

Bioinformatics Tool for TBC1D32 Antibody (NBP1-90777)

Discover related pathways, diseases and genes to TBC1D32 Antibody (NBP1-90777). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on TBC1D32

There are no specific blogs for TBC1D32, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

4
5
0
4
1
3
0
2
0
1
0

Mei Deng
02/24/2017
Application: IHC-P
Species: Human and Mouse

Bioinformatics

Gene Symbol C6ORF170