TBC1D32 Antibody - BSA Free

Western Blot: TBC1D32 Antibody [NBP1-90777] - Analysis in human cell line HDLM-2.

Immunocytochemistry/Immunofluorescence: TBC1D32 Antibody [NBP1-90777] - Staining of human cell line U-251 MG shows localization to mitochondria. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: TBC1D32 Antibody [NBP1-90777] - Staining of human liver shows no positivity in hepatocytes as expected.

Western Blot: TBC1D32 Antibody [NBP1-90777] - Analysis in human cell line HEK 293.

Immunohistochemistry-Paraffin: TBC1D32 Antibody [NBP1-90777] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.

Immunohistochemistry-Paraffin: TBC1D32 Antibody [NBP1-90777] - Staining of human cerebral cortex shows moderate cytoplasmic positivity in neurons.

Immunohistochemistry-Paraffin: TBC1D32 Antibody [NBP1-90777] - Staining of human testis shows weak cytoplasmic positivity in cells in seminiferous ducts.

Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.

Analysis in human cell line HDLM-2.

Analysis in human cell line HEK 293.

Staining of human testis shows weak cytoplasmic positivity in cells in seminiferous ducts.

Staining of human liver shows no positivity in hepatocytes as expected.

• Reactivity: Hu, Mu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TBC1D32 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TBC1D32 Antibody - BSA Free (NBP1-90777) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: SVERNHVLVRINLVGGPLERILPPRLLEKSDNPYPWPMFSSYPLPNCYLSDITRNAGIKQDNDLDKLLLCLKISDKQTEWIENCQRQFCKMMKAKPDIISGEALIELLEKFVLHLTESPSECYFPSVEYTATDANVKNE
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: C6ORF170
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  TBC1D32 Recombinant Protein Antigen (NBP1-90777PEP)

Reactivity Notes

Reactivity reported in mouse normal lung tissue section from a verified customer reveiw.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for TBC1D32 Antibody - BSA Free

• bA301B7.2
• bA57L9.1
• BROMI
• C6orf170
• C6orf171
• chromosome 6 open reading frame 170
• dJ310J6.1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Review for TBC1D32 Antibody (NBP1-90777) (1)

Average Rating: 4

(Based on 1 review)

We have 1 review tested in 1 species: Human and Mouse.

reviewed by: Mei Deng IHC-P Human and Mouse 02/24/2017

Summary

• Application: Immunohistochemistry-Paraffin
• Sample Tested: Adult lung,Salivary gland tissue
• Species: Human and Mouse

Comments

• Comments: Nice staining of IHC-P on human and mouse tissue with this antibody at a dilution 1:50. The section was pre-treated by heat mediated antigen retrieval with sodium citrate buffer (pH6).

Bioinformatics

• Gene Symbol: C6ORF170