TBC1D2 Antibody


Western Blot: TBC1D2 Antibody [NBP1-87335] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-569
Immunocytochemistry/ Immunofluorescence: TBC1D2 Antibody [NBP1-87335] - Staining of human cell line U-2 OS shows positivity in cytoplasm.
Immunohistochemistry-Paraffin: TBC1D2 Antibody [NBP1-87335] - Staining of human esophagus shows moderate cytoplasmic and nucleolar positivity in squamous epithelial cells.

Product Details

Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

TBC1D2 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: LLMDKNHAKQQVICKLSEKVTQDFTHPPDQSPLRPDAANRDFLSQQGKIEHLKDDMEAYRTQNCFLNSEIHQVTKIWRKV
Specificity of human TBC1D2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TBC1D2 Protein (NBP1-87335PEP)
Read Publication using NBP1-87335.

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for TBC1D2 Antibody

  • Armus
  • FLJ10702
  • FLJ16244
  • FLJ42782
  • PARIS1member 2A
  • PP8997
  • TBC1 domain family, member 2


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, IHC, IHC-P
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
Species: Hu, Mu, Rt, Bv, Ca, Sh
Applications: WB, ICC/IF
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
Species: Hu
Applications: WB, Flow, ICC/IF
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IF
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, ICC
Species: Hu, Mu, Rt, Op, Pm
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, Flow, CyTOF-ready
Species: Hu
Applications: WB, ELISA, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for TBC1D2 Antibody (NBP1-87335)(1)

We have publications tested in 1 confirmed species: Human.

Filter By Application
All Applications
Filter By Species
All Species

Reviews for TBC1D2 Antibody (NBP1-87335) (0)

There are no reviews for TBC1D2 Antibody (NBP1-87335). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TBC1D2 Antibody (NBP1-87335) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional TBC1D2 Products

Bioinformatics Tool for TBC1D2 Antibody (NBP1-87335)

Discover related pathways, diseases and genes to TBC1D2 Antibody (NBP1-87335). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TBC1D2 Antibody (NBP1-87335)

Discover more about diseases related to TBC1D2 Antibody (NBP1-87335).

Pathways for TBC1D2 Antibody (NBP1-87335)

View related products by pathway.

Blogs on TBC1D2

There are no specific blogs for TBC1D2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our TBC1D2 Antibody and receive a gift card or discount.


Gene Symbol TBC1D2