TATA binding protein TBP Recombinant Protein Antigen

Images

 
There are currently no images for TATA binding protein TBP Protein (NBP2-38610PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

TATA binding protein TBP Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human TBP.

Source: E. coli

Amino Acid Sequence: QQAVAAAAVQQSTSQQATQGTSGQAPQLFHSQTLTTAPLPGTTPLYPS

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
TBP
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38610.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.
Publications
Read Publication using NBP2-38610PEP.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for TATA binding protein TBP Recombinant Protein Antigen

  • GTF2D
  • GTF2D1
  • HDL4
  • MGC126054
  • MGC126055
  • SCA17
  • TATA box binding protein
  • TATA sequence-binding protein
  • TATA-binding factor
  • TATA-box binding protein N-terminal domain
  • TATA-box factor
  • TATA-box-binding protein
  • TF2D
  • TFIIDMGC117320
  • Transcription initiation factor TFIID TBP subunit

Background

Initiation of transcription by RNA polymerase II requires the activities of more than 70 polypeptides. The protein that coordinates these activities is transcription factor IID (TFIID), which binds to the core promoter to position the polymerase properly, serves as the scaffold for assembly of the remainder of the transcription complex, and acts as a channel for regulatory signals. TFIID is composed of the TATA-binding protein TBP and a group of evolutionarily conserved proteins known as TBP-associated factors or TAFs. A distinctive feature of TBP is a long string of glutamines in the N-terminal. This region of the protein modulates the DNA binding activity of the C terminus, and modulation of DNA binding affects the rate of transcription complex formation and initiation of transcription. Mutations that expand the number of CAG repeats encoding this polyglutamine tract, and thus increase the length of the polyglutamine string, are associated with spinocerebellar ataxia 17, a neurodegenerative disorder classified as a polyglutamine disease.TPB is also known to interact with HIV1 Tat protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP3-35718
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-38188
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-41380
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP2-16760
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-77847
Species: Hu, Mu
Applications: ChIP, ELISA, IHC, IHC-P, IP, WB
NB600-232
Species: Hu, Mu
Applications: ChIP, IHC, IHC-P, IP, WB
DPSG10
Species: Hu
Applications: ELISA
3047-CC
Species: Hu
Applications: BA
NBP3-17971
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, IHC, IHC-P, WB
NBP3-15275
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NB300-221
Species: Av, Bv, Ca, Ch, ChHa, Dr, Eq, Fe, Ha, Hu, Mu, Ma-Op, Po, Pm, Rb, Rt, Sh, Ze
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IP, KD, Simple Western, Single-Cell Western, WB
H00002965-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, KD, S-ELISA, WB
AF2128
Species: Mu
Applications: IHC, WB
MAB8930
Species: Hu
Applications: ICC, Simple Western, WB
NB100-61060
Species: Hu, Mu, Rb, V-Vi
Applications: ChIP, IP, WB
H00002968-B01P
Species: Hu
Applications: ICC/IF, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-55335
Species: Hu
Applications: ICC/IF, WB
NBP2-38610PEP
Species: Hu
Applications: AC

Publications for TATA binding protein TBP Protein (NBP2-38610PEP)(1)

Reviews for TATA binding protein TBP Protein (NBP2-38610PEP) (0)

There are no reviews for TATA binding protein TBP Protein (NBP2-38610PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for TATA binding protein TBP Protein (NBP2-38610PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional TATA binding protein TBP Products

Research Areas for TATA binding protein TBP Protein (NBP2-38610PEP)

Find related products by research area.

Blogs on TATA binding protein TBP

There are no specific blogs for TATA binding protein TBP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our TATA binding protein TBP Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol TBP