TAS1R1 Antibody - BSA Free

Immunohistochemistry-Paraffin: TAS1R1 Antibody [NBP2-48624] - Staining of human kidney shows strong granular cytoplasmic positivity in cells in tubules.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TAS1R1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TAS1R1 Antibody - BSA Free (NBP2-48624) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: LSRHITGVPGIQRIGMVLGVAIQKRAVPGLKAFEEAYARADKEAPRPCHKGSWCSSNQLCRECQAFMAHTMPKLKAFSMSSAYNAYRAVYAVAH
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TAS1R1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  TAS1R1 Recombinant Protein Antigen (NBP2-48624PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for TAS1R1 Antibody - BSA Free

• GPR70
• G-protein coupled receptor 70
• seven transmembrane helix receptor
• T1R1TR1G protein-coupled receptor 70
• taste receptor type 1 member 1
• taste receptor, type 1, member 1

Background

FUNCTION: Putative taste receptor. TAS1R1/TAS1R3 responds to the umami taste stimulus (the taste of monosodium glutamate) and also to most of the 20 standard L-amino acids, but not to their D-enantiomers or other compounds. Sequence differences within and between species can significantly influence the selectivity and specificity of taste responses.; SUBUNIT: Forms heterodimers with TAS1R3.; SUBCELLULAR LOCATION: Cell membrane; Multi-pass membrane protein.; TISSUE SPECIFICITY: Expressed strongly only in fungiform papillae.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TAS1R1