TAO Kinase 1 Antibody (6L4S9)

Western Blot: TAO Kinase 1 Antibody (6L4S9) [NBP3-33291] - Western blot analysis of various lysates, using TAO Kinase 1 Rabbit mAb at1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 3s.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA
• Clone: 6L4S9
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

TAO Kinase 1 Antibody (6L4S9) Summary

• Description: Novus Biologicals Rabbit TAO Kinase 1 Antibody (6L4S9) (NBP3-33291) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 900-985 of human TAO Kinase 1 (NP_065842.1).
  
  Sequence:
  FSHSYPGASGWSHNPTGGPGPHWGHPMGGPPQAWGHPMQGGPQPWGHPSGPMQGVPRGSSMGVRNSPQALRRTASGGRTEQGMSRS
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: TAOK1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 ug/mL
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 116 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for TAO Kinase 1 Antibody (6L4S9)

• EC 2.7.11
• FLJ14314
• hKFC-B
• hTAOK1
• KIAA1361
• KIAA1361STE20-like kinase PSK2
• Kinase from chicken homolog B
• MAP3K16
• MAP3K16EC 2.7.11.1
• MARK Kinase
• MARKK
• MARKKmicrotubule affinity regulating kinase kinase
• PSK2
• PSK-2
• PSK2serine/threonine kinase TAO1
• serine/threonine-protein kinase TAO1
• TAO Kinase 1
• TAO1serine/threonine protein kinase TAO1 homolog
• TAOK1
• Thousand and one amino acid protein 1

Background

TAOK1, a member of the Ste20 kinase family, is a TAO type protein kinase that acts as an upstream activator to MARK by phosphorylation. When activated, MARK enhances microtubule dynamics and leads to phosphorylation and detachment of tau or equivalent MAPs from microtubules. Overexpression of MARK eventually leads to microtubule breakdown and cell death, but in neuronal cells the primary effect is to allow the development of neurites during differentiation.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TAOK1