TADA3L Antibody - BSA Free

Western Blot: TADA3L Antibody [NBP2-94077] - Analysis of extracts of various cell lines, using TADA3L at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit . Exposure time: 10s.

Immunocytochemistry/Immunofluorescence: TADA3L Antibody [NBP2-94077] - Analysis of C6 cells using TADA3L at dilution of 1:100. Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TADA3L Antibody - BSA Free Summary

• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 270-369 of human TADA3 (NP_597814.1). EENIISPMEDSPIPDMSGKESGADGASTSPRNQNKPFSVPHTKSLESRIKEELIAQGLLESEDRPAEDSEDEVLAELRKRQAELKALSAHNRTKKHDLLR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TADA3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:50-1:200
  • Western Blot 1:500-1:2000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for TADA3L Antibody - BSA Free

• ADA3 homolog
• ADA3
• alteration/deficiency in activation 3
• epididymis secretory sperm binding protein
• FLJ20221
• FLJ21329
• hADA3
• NGG1
• STAF54
• TADA3L
• transcriptional adapter 3
• Transcriptional adapter 3-like
• transcriptional adaptor 3

Background

Many DNA-binding transcriptional activator proteins enhance the initiation rate of RNA polymerase II-mediated genetranscription by interacting functionally with the general transcription machinery bound at the basal promoter.Adaptor proteins are usually required for this activation, possibly to acetylate and destabilize nucleosomes, therebyrelieving chromatin constraints at the promoter. The protein encoded by this gene is a transcriptional activatoradaptor and has been found to be part of the PCAF histone acetylase complex. In addition, it associates with the tumorsuppressor protein p53 and is required for full activity of p53 and p53-mediated apoptosis. At least fouralternatively spliced variants have been found for this gene, but the full-length nature of some variants has not beendetermined. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: TADA3