TADA3L Antibody

Images

 
Western Blot: TADA3L Antibody [NBP1-90243] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: TADA3L Antibody [NBP1-90243] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm.
Immunohistochemistry-Paraffin: TADA3L Antibody [NBP1-90243] - Staining of human vagina shows strong nuclear positivity in squamous epithelial cells.
Western Blot: TADA3L Antibody [NBP1-90243] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Summary
Reactivity Hu, Mu, Rt, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TADA3L Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LAKEEVSRQELRQRVRMADNEVMDAFRKIMAARQKKRTPTKKEKDQAWKTLKERESILKLLDG
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TADA3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
  • Immunofluorescence 1-4 ug/ml
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TADA3L Protein (NBP1-90243PEP)
Publications
Read Publication using NBP1-90243.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TADA3L Antibody

  • ADA3ADA3 homolog
  • FLJ20221
  • FLJ21329
  • hADA3ADA3-like protein
  • NGG1
  • STAF54
  • TADA3Ltranscriptional adaptor 3 (NGG1 homolog, yeast)-like
  • transcriptional adapter 3
  • Transcriptional adapter 3-like
  • transcriptional adaptor 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-57507
Species: Hu
Applications: ICC/IF
NBP2-17017
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-89238
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP1-87404
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00008850-M04
Species: Hu
Applications: WB, ELISA, ICC/IF
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-56629
Species: Hu
Applications: WB
NBP2-12933
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
NBP2-45466
Species: Hu
Applications: WB, IHC
NB100-616
Species: Hu, Mu, Rt, Md, Pm
Applications: WB, ChIP, EM, ICC/IF, IP, In vitro, Flow-IC
AF7365
Species: Hu, Mu, Rt
Applications: WB
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NB200-322
Species: Hu, Mu, Rt
Applications: WB, IHC-Fr
NB100-57524
Species: Hu
Applications: WB, IHC, IHC-P, IP
NB300-619
Species: Hu, Mu, Rt, Bv, Ch, Ha
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-07996
Species: Hu
NBP1-90813
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-52486
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
NBP1-90243
Species: Hu, Mu, Rt, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IF

Publications for TADA3L Antibody (NBP1-90243)(1)

Reviews for TADA3L Antibody (NBP1-90243) (0)

There are no reviews for TADA3L Antibody (NBP1-90243). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TADA3L Antibody (NBP1-90243) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TADA3L Products

Bioinformatics Tool for TADA3L Antibody (NBP1-90243)

Discover related pathways, diseases and genes to TADA3L Antibody (NBP1-90243). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TADA3L Antibody (NBP1-90243)

Discover more about diseases related to TADA3L Antibody (NBP1-90243).
 

Pathways for TADA3L Antibody (NBP1-90243)

View related products by pathway.

PTMs for TADA3L Antibody (NBP1-90243)

Learn more about PTMs related to TADA3L Antibody (NBP1-90243).
 

Research Areas for TADA3L Antibody (NBP1-90243)

Find related products by research area.

Blogs on TADA3L

There are no specific blogs for TADA3L, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TADA3L Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TADA3