TADA3L Antibody

Images

 
Western Blot: TADA3L Antibody [NBP1-90243] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: TADA3L Antibody [NBP1-90243] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry: TADA3L Antibody [NBP1-90243] - PCAF,TADA3L, and PACS1 protein expression is reduced in human gastric tumor tissue. A tissue microarray (TMA) containing gastric tumor tissue (Tumor) and ...read more
Western Blot: TADA3L Antibody [NBP1-90243] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: TADA3L Antibody [NBP1-90243] - Staining of human vagina shows strong nuclear positivity in squamous epithelial cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TADA3L Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LAKEEVSRQELRQRVRMADNEVMDAFRKIMAARQKKRTPTKKEKDQAWKTLKERESILKLLDG
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TADA3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
  • Western Blot 1:100-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
TADA3L Recombinant Protein Antigen (NBP1-90243PEP)
Publications
Read Publications using
NBP1-90243 in the following applications:

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for TADA3L Antibody

  • ADA3 homolog
  • ADA3
  • alteration/deficiency in activation 3
  • epididymis secretory sperm binding protein
  • FLJ20221
  • FLJ21329
  • hADA3
  • NGG1
  • STAF54
  • TADA3L
  • transcriptional adapter 3
  • Transcriptional adapter 3-like
  • transcriptional adaptor 3

Background

Many DNA-binding transcriptional activator proteins enhance the initiation rate of RNA polymerase II-mediated genetranscription by interacting functionally with the general transcription machinery bound at the basal promoter.Adaptor proteins are usually required for this activation, possibly to acetylate and destabilize nucleosomes, therebyrelieving chromatin constraints at the promoter. The protein encoded by this gene is a transcriptional activatoradaptor and has been found to be part of the PCAF histone acetylase complex. In addition, it associates with the tumorsuppressor protein p53 and is required for full activity of p53 and p53-mediated apoptosis. At least fouralternatively spliced variants have been found for this gene, but the full-length nature of some variants has not beendetermined. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-86955
Species: Hu
Applications: WB
NBP2-17017
Species: Hu, Mu
Applications: ICC/IF, WB
NBP1-89238
Species: Hu
Applications: IHC, IHC-P, Simple Western, WB
NBP1-87404
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, KD, WB
2695-SE
Species: Hu
Applications: EnzAct
H00008850-M04
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP3-13853
Species: Hu
Applications: Flow, IP, PA, WB
NBP3-13174
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-45466
Species: Hu, Mu, Rt
Applications: IHC, PAGE, WB
NB100-616
Species: Hu, Mu, Md, Pm, Rt
Applications: ChIP, EM, Flow-IC, Flow, ICC/IF, IP, In vitro, WB
AF7365
Species: Hu, Mu, Rt
Applications: WB
NBP2-29463
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB200-322
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, WB
NBP2-61879
Species: Hu, Mu
Applications: ELISA, Flow, IHC, IHC-P, WB
NB300-619
Species: Bv, Ch, Ha, Hu, Mu, Rt
Applications: ICC, ICC/IF, IHC, IHC-P, IP, WB
NBP2-07996
Species: Hu
Applications: WB
NBP1-90813
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-52486
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NBP1-90243
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P

Publications for TADA3L Antibody (NBP1-90243)(2)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC-P.


Filter By Application
IHC-P
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for TADA3L Antibody (NBP1-90243) (0)

There are no reviews for TADA3L Antibody (NBP1-90243). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TADA3L Antibody (NBP1-90243) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TADA3L Products

Bioinformatics Tool for TADA3L Antibody (NBP1-90243)

Discover related pathways, diseases and genes to TADA3L Antibody (NBP1-90243). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TADA3L Antibody (NBP1-90243)

Discover more about diseases related to TADA3L Antibody (NBP1-90243).
 

Pathways for TADA3L Antibody (NBP1-90243)

View related products by pathway.

PTMs for TADA3L Antibody (NBP1-90243)

Learn more about PTMs related to TADA3L Antibody (NBP1-90243).
 

Research Areas for TADA3L Antibody (NBP1-90243)

Find related products by research area.

Blogs on TADA3L

There are no specific blogs for TADA3L, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TADA3L Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TADA3