TADA3L Antibody - BSA Free

Staining of human cell line U-2 OS shows localization to nucleoplasm.

Staining of human prostate shows weak to moderate nuclear positivity in glandular cells.

Staining of human Fallopian tube shows strong nuclear positivity in glandular cells.

Staining of human liver shows no positivity in hepatocytes as expected.

Staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts.

Analysis in human cell line MCF-7.

TADA3L-Antibody-Immunohistochemistry-NBP1-90243-img0008.jpg

ChIP-Exo-Seq composite graph for Anti-TADA3 (NBP1-90243) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF, IHC, ChIP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

TADA3L Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TADA3L Antibody - BSA Free (NBP1-90243) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-TADA3L Antibody: Cited in 3 publications. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LAKEEVSRQELRQRVRMADNEVMDAFRKIMAARQKKRTPTKKEKDQAWKTLKERESILKLLDG
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TADA3
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Chromatin Immunoprecipitation-exo-Seq
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50-1:200
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF,Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  TADA3L Recombinant Protein Antigen (NBP1-90243PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for TADA3L Antibody - BSA Free

• ADA3 homolog
• ADA3
• alteration/deficiency in activation 3
• epididymis secretory sperm binding protein
• FLJ20221
• FLJ21329
• hADA3
• NGG1
• STAF54
• TADA3L
• transcriptional adapter 3
• Transcriptional adapter 3-like
• transcriptional adaptor 3

Background

Many DNA-binding transcriptional activator proteins enhance the initiation rate of RNA polymerase II-mediated genetranscription by interacting functionally with the general transcription machinery bound at the basal promoter.Adaptor proteins are usually required for this activation, possibly to acetylate and destabilize nucleosomes, therebyrelieving chromatin constraints at the promoter. The protein encoded by this gene is a transcriptional activatoradaptor and has been found to be part of the PCAF histone acetylase complex. In addition, it associates with the tumorsuppressor protein p53 and is required for full activity of p53 and p53-mediated apoptosis. At least fouralternatively spliced variants have been found for this gene, but the full-length nature of some variants has not beendetermined. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for TADA3L Antibody (NBP1-90243)(3)

Publications using NBP1-90243

• BraSacchio D, Busuttil RA, Noori T et al. Down-regulation of a pro-apoptotic pathway regulated by PCAF/ADA3 in early stage gastric cancer. Cell Death Dis 2018-04-18 [PMID: 29670108] (IHC-P, Human)
• L Galvan, L Francelle, MC Gaillard, L de Longpre, MA Carrillo-d, G Liot, K Cambon, L Stimmer, S Luccantoni, J Flament, J Valette, M de Chaldée, G Auregan, M Guillermie, C Joséphine, F Petit, C Jan, M Jarrige, N Dufour, G Bonvento, S Humbert, F Saudou, P Hantraye, K Merienne, AP Bemelmans, AL Perrier, N Déglon, E Brouillet The striatal kinase DCLK3 produces neuroprotection against mutant huntingtin Brain, 2018-05-01;0(0):. 2018-05-01 [PMID: 29534157]
• Stadler C, Rexhepaj E, Singan VR et al. Immunofluorescence and fluorescent-protein tagging show high correlation for protein localization in mammalian cells. Nat Methods 2013-04-01 [PMID: 23435261]

Bioinformatics

• Gene Symbol: TADA3