TAB1 Antibody (2W0P2)

Western Blot: TAB1 Antibody (2W0P2) [NBP3-16167] - Western blot analysis of extracts of various cell lines, using TAB1 Rabbit mAb (NBP3-16167) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 90s.

Immunocytochemistry/ Immunofluorescence: TAB1 Antibody (2W0P2) [NBP3-16167] - Immunofluorescence analysis of U-2 OS cells using TAB1 Rabbit mAb at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF
• Clone: 2W0P2
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

TAB1 Antibody (2W0P2) Summary

• Description: Novus Biologicals Rabbit TAB1 Antibody (2W0P2) (NBP3-16167) is a recombinant monoclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 405-504 of human TAB1 (Q15750). VTLSLVMPSQGQMVNGAHSASTLDEATPTLTNQSPTLTLQSTNTHTQSSSSSSDGGLFRSRPAHSLPPGEDGRVEPYVDFAEFYRLWSVDHGEQSVVTAP
• Source: HEK293
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: TAB1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for TAB1 Antibody (2W0P2)

• MAP3K7IP1
• MAP3K7IP13'-Tab1
• MGC57664
• mitogen-activated protein kinase kinase kinase 7 interacting protein 1
• Mitogen-activated protein kinase kinase kinase 7-interacting protein 1
• TAB1
• TAK1-binding protein 1
• TGF-beta activated kinase 1/MAP3K7 binding protein 1
• TGF-beta-activated kinase 1 and MAP3K7-binding protein 1
• TGF-beta-activated kinase 1-binding protein 1
• transforming growth factor beta-activated kinase-binding protein 1

Background

TAB1, TAK1 binding protein, enhances activity of the plasminogen activator inhibitor 1 gene promoter, which is regulated by TGF-beta, and increases the kinase activity of TAK1. TAB1 may function as an activator of the TAK1 MAPKKK in TGF-beta signal transduction (1). Findings suggest that alternative activation pathways contribute to the biological responses of p38alpha to various stimuli. Interaction of p38alpha with TAB1 leads to autophosphorylation and activation of p38alpha (2).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TAB1