TAAR9 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit TAAR9 Antibody - BSA Free (NBP2-86841) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human TAAR9. Peptide sequence: RVAKRERKAAKTLGIAMAAFLVSWLPYLVDAVIDAYMNFITPPYVYEILV The peptide sequence for this immunogen was taken from within the described region. |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
TAAR9 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS, 2% Sucrose |
| Preservative |
0.09% Sodium Azide |
| Concentration |
0.5 mg/ml |
| Purity |
Affinity purified |
Alternate Names for TAAR9 Antibody - BSA Free
Background
TAAR9/TA3 is an Orphan-A GPCR because the ligand has not been identified. TAAR9/TA3 was identified by degenerate PCR because of its similarity to other trace amine receptors. The close proximity on chromosome 6 and high sequence homology to the other trace amine receptors suggest that TAAR9/TA3 is likely to bind a related or unidentified amine. TAAR9/TA3 has been reported to be expressed only in kidney.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA
Species: Hu, Pm
Applications: IHC, IHC-P, WB
Species: Mu
Applications: IP, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Pm, Mu
Applications: IHC, IHC-P, WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Ch, Mu
Applications: ELISA, IHC, Single-Cell Western, WB
Species: Mu
Applications: CyTOF-ready, Flow, ICC, IHC, WB
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP, KO, Simple Western, WB
Species: Hu
Applications: Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: WB
Publications for TAAR9 Antibody (NBP2-86841) (0)
There are no publications for TAAR9 Antibody (NBP2-86841).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for TAAR9 Antibody (NBP2-86841) (0)
There are no reviews for TAAR9 Antibody (NBP2-86841).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for TAAR9 Antibody (NBP2-86841) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional TAAR9 Products
Research Areas for TAAR9 Antibody (NBP2-86841)
Find related products by research area.
|
Blogs on TAAR9