TAAR9 Antibody - BSA Free

Western Blot: TAAR9 Antibody [NBP2-86841] - Host: Rabbit. Target Name: TAAR9. Sample Type: Fetal Liver lysates. Antibody Dilution: 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

TAAR9 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit TAAR9 Antibody - BSA Free (NBP2-86841) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human TAAR9. Peptide sequence: RVAKRERKAAKTLGIAMAAFLVSWLPYLVDAVIDAYMNFITPPYVYEILV The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TAAR9
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for TAAR9 Antibody - BSA Free

• TA3TAR3TAR9
• TaR-3
• TaR-9
• trace amine associated receptor 9 (gene/pseudogene)
• trace amine associated receptor 9
• Trace amine receptor 3trace amine-associated receptor 9
• Trace amine receptor 9
• TRAR3

Background

TAAR9/TA3 is an Orphan-A GPCR because the ligand has not been identified. TAAR9/TA3 was identified by degenerate PCR because of its similarity to other trace amine receptors. The close proximity on chromosome 6 and high sequence homology to the other trace amine receptors suggest that TAAR9/TA3 is likely to bind a related or unidentified amine. TAAR9/TA3 has been reported to be expressed only in kidney.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TAAR9