TAAR5 Antibody

Images

 
Western Blot: TAAR5 Antibody [NBP1-68902] - Antibody Titration: 1 ug/ml Human OVCAR-3.
Immunocytochemistry/ Immunofluorescence: TAAR5 Antibody [NBP1-68902] - Spinal Cord, ventral horns, Dilution: 1.3ug/mL
Western Blot: TAAR5 Antibody [NBP1-68902] - Titration: 0.2-1 ug/ml, Positive Control: PANC1 cell lysate.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

TAAR5 Antibody Summary

Immunogen
Synthetic peptides corresponding to TAAR5 (trace amine associated receptor 5) The peptide sequence was selected from the C terminal of TAAR5. Peptide sequence TTLSKSLAGAAKHERKAAKTLGIAVGIYLLCWLPFTIDTMVDSLLHFITP.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TAAR5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
  • Immunocytochemistry/Immunofluorescence 1:10-1:2000
Application Notes
This is a rabbit polyclonal antibody against TAAR5 and was validated on Western blot.
Theoretical MW
38 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for TAAR5 Antibody

  • MGC138414
  • MGC138416
  • PNRRP11-295F4.5
  • Putative neurotransmitter receptor
  • taR-5
  • trace amine associated receptor 5
  • Trace amine receptor 5
  • trace amine-associated receptor 5

Background

TAAR5 is an orphan receptor. Ligands are likely small molecules, either sharing some similarities with trace amine as, e.g. derivatives of indolamines (such as 5-methoxytryptamine) or of phenylethylamines (such as phenylethanolamine) or being any kind of metabolite of amino acids or biogenic amine neurotransmitters.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

PP-H7223-00
Species: Hu
Applications: WB, IHC, DirELISA
NBP2-37477
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NLS2573
Species: Hu
Applications: IHC-P
46780002
Species: Hu
Applications: ELISA
NBP1-77060
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-87992
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
AF1620
Species: Mu
Applications: WB, IHC
H00009287-R03
Species: Hu
AF4928
Species: Hu
Applications: WB, Flow, CyTOF-ready
PP-H6506-00
Species: Hu
Applications: WB, IP, DirELISA
NBP2-60655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF5415
Species: Hu
Applications: WB, IHC, ICC
NBP1-89296
Species: Hu
Applications: WB, IHC, IHC-P
NBL1-12154
Species: Hu
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-71770
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-68902
Species: Hu, Mu
Applications: WB, ICC/IF

Publications for TAAR5 Antibody (NBP1-68902) (0)

There are no publications for TAAR5 Antibody (NBP1-68902).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for TAAR5 Antibody (NBP1-68902) (0)

There are no reviews for TAAR5 Antibody (NBP1-68902). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for TAAR5 Antibody (NBP1-68902) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional TAAR5 Products

Bioinformatics Tool for TAAR5 Antibody (NBP1-68902)

Discover related pathways, diseases and genes to TAAR5 Antibody (NBP1-68902). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for TAAR5 Antibody (NBP1-68902)

Discover more about diseases related to TAAR5 Antibody (NBP1-68902).
 

Pathways for TAAR5 Antibody (NBP1-68902)

View related products by pathway.

Research Areas for TAAR5 Antibody (NBP1-68902)

Find related products by research area.

Blogs on TAAR5

There are no specific blogs for TAAR5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our TAAR5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TAAR5
Uniprot