t-Plasminogen Activator/tPA Antibody (10W4L1) Summary
Additional Information |
Recombinant Monoclonal Antibody |
Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 463-562 of human tPA/t-Plasminogen Activator/tPA (P00750). LKEAHVRLYPSSRCTSQHLLNRTVTDNMLCAGDTRSGGPQANLHDACQGDSGGPLVCLNDGRMTLVGIISWGLGCGQKDVPGVYTKVTNYLDWIRDNMRP |
Isotype |
IgG |
Clonality |
Monoclonal |
Host |
Rabbit |
Gene |
PLAT |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
- Western Blot 1:500 - 1:1000
|
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.3), 50% glycerol, 0.05% BSA |
Preservative |
0.02% Sodium Azide |
Purity |
Affinity purified |
Alternate Names for t-Plasminogen Activator/tPA Antibody (10W4L1)
Background
Tissue plasminogen activator (tPA) is a serine protease which converts the abundant proenzyme plasminogen to active plasmin. It plays a key role in thrombolysis (1) and several neurobiological processes (2).
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA
Species: Hu
Applications: EnzAct
Species: Hu
Applications: WB
Species: Hu
Applications: CyTOF-ready, Flow, ICC, KO, WB
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Species: Hu, Mu
Applications: ELISA, IHC, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: ELISA, ICC/IF, WB
Species: Ca, Fe, Hu, Mu
Applications: Dual ISH-IHC, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: CyTOF-ready, Flow, Simple Western, WB
Species: Hu
Applications: IP, Neut, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu
Applications: ELISA
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Publications for t-Plasminogen Activator/tPA Antibody (NBP3-16356) (0)
There are no publications for t-Plasminogen Activator/tPA Antibody (NBP3-16356).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for t-Plasminogen Activator/tPA Antibody (NBP3-16356) (0)
There are no reviews for t-Plasminogen Activator/tPA Antibody (NBP3-16356).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for t-Plasminogen Activator/tPA Antibody (NBP3-16356) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional t-Plasminogen Activator/tPA Products
Research Areas for t-Plasminogen Activator/tPA Antibody (NBP3-16356)
Find related products by research area.
|
Blogs on t-Plasminogen Activator/tPA