t-Plasminogen Activator/tPA Antibody (10W4L1)

Western Blot: t-Plasminogen Activator/tPA Antibody (10W4L1) [NBP3-16356] - Western blot analysis of extracts of various cell lines, using tPA/t-Plasminogen Activator/tPA Rabbit mAb (NBP3-16356) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 10s.

Immunocytochemistry/Immunofluorescence: t-Plasminogen Activator/tPA Antibody (10W4L1) [NBP3-16356] - Human placenta using tPA/PLAT Rabbit mAb (at dilution of 1:100) (Red). DAPI was used for nuclear staining (blue). Objective: 40x. Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IF staining protocol.

Immunocytochemistry/Immunofluorescence: t-Plasminogen Activator/tPA Antibody (10W4L1) [NBP3-16356] - NIH/3T3 cells using tPA/PLAT Rabbit mAb (at dilution of 1:100) (Red). The cells were counterstained with alpha -Tubulin Mouse mAb (dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 100x.

Immunocytochemistry/ Immunofluorescence: t-Plasminogen Activator/tPA Antibody (10W4L1) [NBP3-16356] - Confocal imaging of human placenta using t-Plasminogen Activator/tPA Rabbit mAb . DAPI was used for nuclear staining (blue). Objective: 40x. Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IF staining protocol.

Immunocytochemistry/ Immunofluorescence: t-Plasminogen Activator/tPA Antibody (10W4L1) [NBP3-16356] - Confocal imaging of NIH/3T3 cells using t-Plasminogen Activator/tPA Rabbit mAb . The cells were counterstained with alpha-Tubulin Mouse mAb (Green). DAPI was used for nuclear staining (blue). Objective: 100x.

Immunocytochemistry/ Immunofluorescence: t-Plasminogen Activator/tPA Antibody (10W4L1) [t-Plasminogen Activator/tPA] - Confocal imaging of human placenta using t-Plasminogen Activator/tPA Rabbit mAb . DAPI was used for nuclear staining (blue). Objective: 40x. Perform high pressure antigen retrieval with 10 mM citrate buffer pH 6.0 before commencing with IF staining protocol.

Immunocytochemistry/ Immunofluorescence: t-Plasminogen Activator/tPA Antibody (10W4L1) [t-Plasminogen Activator/tPA] - Confocal imaging of NIH/3T3 cells using t-Plasminogen Activator/tPA Rabbit mAb . The cells were counterstained with alpha-Tubulin Mouse mAb (Green). DAPI was used for nuclear staining (blue). Objective: 100x.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF
• Clone: 10W4L1
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

t-Plasminogen Activator/tPA Antibody (10W4L1) Summary

• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 463-562 of human tPA/t-Plasminogen Activator/tPA (P00750). LKEAHVRLYPSSRCTSQHLLNRTVTDNMLCAGDTRSGGPQANLHDACQGDSGGPLVCLNDGRMTLVGIISWGLGCGQKDVPGVYTKVTNYLDWIRDNMRP
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: PLAT
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for t-Plasminogen Activator/tPA Antibody (10W4L1)

• Alteplase
• DKFZp686I03148
• EC 3.4.21
• EC 3.4.21.68
• plasminogen activator, tissue type
• plasminogen activator, tissue
• PLAT
• Reteplase
• tissue plasminogen activator (t-PA)
• tissue-type plasminogen activator
• tPA
• T-PA
• tPlasminogen Activator
• t-Plasminogen Activator

Background

Tissue plasminogen activator (tPA) is a serine protease which converts the abundant proenzyme plasminogen to active plasmin. It plays a key role in thrombolysis (1) and several neurobiological processes (2).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: PLAT