Syntrophin Antibody - BSA Free

Immunohistochemistry-Paraffin: Syntrophin Antibody [NBP3-17941] - Staining of human cerebral cortex shows strong cytoplasmic positivity in glial cells and endothelial cells.

• Reactivity: Hu, Mu, Rt
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Syntrophin Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit Syntrophin Antibody - BSA Free (NBP3-17941) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: GTRHGVDTHLFSVESPQELAAWTRQLVDGCHRAAEGVQEVSTACTWNGRPCSLSVHIDKGFTLWAAEPGAARAVLLRQPFEKLQMS
• Predicted Species: Mouse (98%), Rat (98%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SNTA1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Syntrophin Antibody - BSA Free

• 59 kDa dystrophin-associated protein A1 acidic component 1
• dJ1187J4.5
• LQT12
• Pro-TGF-alpha cytoplasmic domain-interacting protein 1
• SNT1alpha-1-syntrophin
• syntrophin, alpha 1 (dystrophin-associated protein A1, 59kD, acidic component)
• syntrophin, alpha 1 (dystrophin-associated protein A1, 59kDa, acidic component)
• syntrophin-1
• TACIP1acidic alpha 1 syntrophin

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SNTA1