Syntaxin-BP1 Antibody (1N7U1)

Western Blot: Syntaxin-BP1 Antibody (1N7U1) [NBP3-33541] - Western blot analysis of lysates from HeLa cells, using Syntaxin-BP1 Rabbit mAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 3s.

Immunohistochemistry: Syntaxin-BP1 Antibody (1N7U1) [NBP3-33541] - Immunohistochemistry analysis of Syntaxin-BP1 in paraffin-embedded human pancreas tissue using Syntaxin-BP1 Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: Syntaxin-BP1 Antibody (1N7U1) [NBP3-33541] - Immunohistochemistry analysis of Syntaxin-BP1 in paraffin-embedded rat pancreas tissue using Syntaxin-BP1 Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: Syntaxin-BP1 Antibody (1N7U1) [NBP3-33541] - Immunohistochemistry analysis of Syntaxin-BP1 in paraffin-embedded human brain tissue using Syntaxin-BP1 Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry: Syntaxin-BP1 Antibody (1N7U1) [NBP3-33541] - Immunohistochemistry analysis of Syntaxin-BP1 in paraffin-embedded mouse pancreas tissue using Syntaxin-BP1 Rabbit mAb at a dilution of 1:200 (40x lens).High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA, IHC
• Clone: 1N7U1
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

Syntaxin-BP1 Antibody (1N7U1) Summary

• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 400-500 of human Syntaxin-BP1 (P61764).
  
  Sequence:
  STYDKIRIILLYIFLKNGITEENLNKLIQHAQIPPEDSEIITNMAHLGVPIVTDSTLRRRSKPERKERISEQTYQLSRWTPIIKDIMEDTIEDKLDTKHYP
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: STXBP1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 ug/mL
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 68 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Syntaxin-BP1 Antibody (1N7U1)

• EIEE4
• FLJ37475
• hUNC18
• MUNC18-1
• NSEC1
• N-Sec1
• p67
• Protein unc-18 homolog 1
• Protein unc-18 homolog A
• rbSec1
• STXBP1
• syntaxin binding protein 1
• syntaxin-binding protein 1
• SyntaxinBP1
• Syntaxin-BP1
• UNC18
• unc18-1
• UNC18A
• unc-18A
• UNC18neuronal SEC1

Background

Munc-18 (mammalian homologue of Unc-18) is a protein that is thought to be involved in regulating exocytosis due, at least in part to its ability to bind syntaxin (Ciufo et al., 2005). Munc18-1 is a neuron-specific member of the Sec1/Munc18 protein family that binds to syntaxin1A and is thought to stabilize the complex (Liu et al., 2004). The function of Munc-18 is thought to be regulated by PKC phosphorylation of Ser515 on the Munc-18 protein (Sassa et al., 1996).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: STXBP1