Syntaxin Binding Protein 4 Antibody - BSA Free Summary
Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: GMEMDYEEVIRLLEAKITELKAQLADYSDQNKESVQDLKKRIMVLDCQLRKSEMARKTFEASTEKLLHFVEAIQEVFSDNSTPLSNLSERRAVLASQT |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
STXBP4 |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Immunohistochemistry 1:500 - 1:1000
- Immunohistochemistry-Paraffin 1:500 - 1:1000
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
Control Peptide |
|
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (84%)
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for Syntaxin Binding Protein 4 Antibody - BSA Free
Background
Synip (Syntaxin 4-Interacting protein) specifically binds to Syntaxin 4 and is uniquely expressed in muscle and adipose tissue. The binding interaction of Synip with syntaxin 4 is regulated by insulin, which also induces dissociation of the Synip-syntaxin 4 complex. Synip plays a role in the translocation of transport vesicles from the cytoplasm to the plasma membrane and functions as a positive regulator of insulin-stimulated GLUT4 translocation. Synip also competes with VAMP2 but Not SNAP23 for binding to Syntaxin 4 (1-3).
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Pl, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, KD, WB
Species: Bv, Hu, Mu
Applications: CyTOF-ready, ICC, IHC, ICFlow
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
Species: Bv, Mu, Pm, Rt
Applications: Flow, IF, IHC, IHC-P, IP, WB
Species: Hu
Applications: Simple Western, WB
Species: Ca, Hu, Pm
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, WB
Species: Hu
Applications: WB
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: WB
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
Species: Ch, Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, PA, WB
Species: Hu
Applications: IHC
Publications for Syntaxin Binding Protein 4 Antibody (NBP1-92469) (0)
There are no publications for Syntaxin Binding Protein 4 Antibody (NBP1-92469).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Syntaxin Binding Protein 4 Antibody (NBP1-92469) (0)
There are no reviews for Syntaxin Binding Protein 4 Antibody (NBP1-92469).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
FAQs for Syntaxin Binding Protein 4 Antibody (NBP1-92469) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Syntaxin Binding Protein 4 Products
Research Areas for Syntaxin Binding Protein 4 Antibody (NBP1-92469)
Find related products by research area.
|
Blogs on Syntaxin Binding Protein 4