SynGAP Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: SynGAP Antibody [NBP1-87841] - Immunofluorescent staining of human cell line A-431 shows localization to nucleus.
Immunohistochemistry-Paraffin: SynGAP Antibody [NBP1-87841] - Staining of human hippocampus shows positivity in neuronal processes.

Product Details

Summary
Reactivity Hu, RtSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SynGAP Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LHLYRDSDKKRKKDKAGYVGLVTVPVATLAGRHFTEQWYPVTLPTGSGGSGGMGSGGGGGSGGGSGGKGKGGCPAVRLKARYQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SYNGAP1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:10-1:20
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
SynGAP Recombinant Protein Antigen (NBP1-87841PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SynGAP Antibody

  • DKFZp761G1421
  • KIAA1938135kDa
  • MRD5
  • synaptic Ras GTPase activating protein 1 homolog (rat)
  • synaptic Ras GTPase activating protein 1
  • Synaptic Ras-GAP 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-556
Species: Hu, Mu, Rt, In, Pm
Applications: WB, ChIP, B/N, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NB300-556
Species: Hu, Mu, Rt, In, Pm
Applications: WB, ChIP, B/N, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-87839
Species: Hu
Applications: IHC, IHC-P
NBP1-84212
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15083
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NB300-106
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IP
NBP2-00594
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-89334
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2180
Species: Hu
Applications: WB, Simple Western, IP
NB300-105
Species: Hu, Mu, Rt, Rb
Applications: WB, IHC, IHC-P, IP
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-58844
Species: Hu
Applications: ICC/IF
NB100-1617
Species: Hu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-24738
Species: Hu, Mu, Pm
Applications: WB, IHC-P

Publications for SynGAP Antibody (NBP1-87841) (0)

There are no publications for SynGAP Antibody (NBP1-87841).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SynGAP Antibody (NBP1-87841) (0)

There are no reviews for SynGAP Antibody (NBP1-87841). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SynGAP Antibody (NBP1-87841) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional SynGAP Products

Bioinformatics Tool for SynGAP Antibody (NBP1-87841)

Discover related pathways, diseases and genes to SynGAP Antibody (NBP1-87841). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SynGAP Antibody (NBP1-87841)

Discover more about diseases related to SynGAP Antibody (NBP1-87841).
 

Pathways for SynGAP Antibody (NBP1-87841)

View related products by pathway.

PTMs for SynGAP Antibody (NBP1-87841)

Learn more about PTMs related to SynGAP Antibody (NBP1-87841).
 

Research Areas for SynGAP Antibody (NBP1-87841)

Find related products by research area.

Blogs on SynGAP

There are no specific blogs for SynGAP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SynGAP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SYNGAP1