SynGAP Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: SynGAP Antibody [NBP1-87841] - Immunofluorescent staining of human cell line A-431 shows localization to nucleus. Antibody staining is shown in green.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SynGAP Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SynGAP Antibody - BSA Free (NBP1-87841) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: LHLYRDSDKKRKKDKAGYVGLVTVPVATLAGRHFTEQWYPVTLPTGSGGSGGMGSGGGGGSGGGSGGKGKGGCPAVRLKARYQ
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SYNGAP1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  SynGAP Recombinant Protein Antigen (NBP1-87841PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SynGAP Antibody - BSA Free

• DKFZp761G1421
• KIAA1938135kDa
• MRD5
• synaptic Ras GTPase activating protein 1 homolog (rat)
• synaptic Ras GTPase activating protein 1
• Synaptic Ras-GAP 1

Background

Synaptic Ras GTPase Activating Protein (SynGAP) is a PDZ-domain interacting protein expressed almost exclusively in the brain. SynGAP has been shown to be a major component of postsynaptic density and associates with post synaptic density 95 kDa (PSD-95), a synaptic scaffold protein, and synaptic N-methyl-D-aspartate (NMDA) receptors. SynGAP Ras-GTPase activity has also been shown to be inhibited by phosphorylation by CaM kinase II, another abundant protein located in the postsynaptic density. It has been proposed that SynGAP may function as a negative regulator of MAP Kinase activation in the absence of active NMDA receptors.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SYNGAP1