Syndecan-4 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Syndecan-4 Antibody [NBP1-90173] - Immunofluorescent staining of human cell line U-251 MG shows localization to plasma membrane & the Golgi apparatus.
Immunohistochemistry-Paraffin: Syndecan-4 Antibody [NBP1-90173] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Syndecan-4 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PQDLLEGRYFSGALPDDEDVVGPGQESDDFELSGSGDLDDLEDSMIGPEVVHPLVPLDNHIPERAGSGSQVPTEPKKLEENEVIPKRISPVEESEDVSNKVSMSSTVQGSNIFERTEV
Marker
Plasma Membrane Marker
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SDC4
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Syndecan-4 Protein (NBP1-90173PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Syndecan-4 Antibody

  • Amphiglycan
  • MGC22217
  • Ryudocan core protein
  • Ryudocan
  • SDC4
  • SYND4ryudocan amphiglycan
  • syndecan 4 (amphiglycan, ryudocan)
  • syndecan 4
  • syndecan proteoglycan 4
  • Syndecan4
  • Syndecan-4

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-64980
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF6585
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready
NBP1-47386
Species: Hu, Mu, Rb(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-33197
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
AF2364
Species: Hu
Applications: WB, IHC
NBP2-23603
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB2734
Species: Mu
Applications: WB
NBP1-85432
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF143
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-84168
Species: Hu
Applications: IHC, IHC-P
NBP2-45923
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-24470
Species: Hu
Applications: WB, Simple Western, IHC-P

Publications for Syndecan-4 Antibody (NBP1-90173) (0)

There are no publications for Syndecan-4 Antibody (NBP1-90173).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Syndecan-4 Antibody (NBP1-90173) (0)

There are no reviews for Syndecan-4 Antibody (NBP1-90173). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Syndecan-4 Antibody (NBP1-90173) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Syndecan-4 Products

Bioinformatics Tool for Syndecan-4 Antibody (NBP1-90173)

Discover related pathways, diseases and genes to Syndecan-4 Antibody (NBP1-90173). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Syndecan-4 Antibody (NBP1-90173)

Discover more about diseases related to Syndecan-4 Antibody (NBP1-90173).
 

Pathways for Syndecan-4 Antibody (NBP1-90173)

View related products by pathway.

PTMs for Syndecan-4 Antibody (NBP1-90173)

Learn more about PTMs related to Syndecan-4 Antibody (NBP1-90173).

Blogs on Syndecan-4

There are no specific blogs for Syndecan-4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Syndecan-4 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SDC4
Entrez