Syndecan-2/CD362 Antibody [Biotin] Summary
| Immunogen |
SDC2 (NP_002989.2, 19 a.a. - 201 a.a.) full-length human protein. ESRAELTSDKDMYLDNSSIEEASGVYPIDDDDYASASGSGADEDVESPELTTTRPLPKILLTSAAPKVETTTLNIQNKIPAQTKSPEETDKEKVHLSDSERKMDPAEEDTNVYTEKHSDSLFKRTEVLAAVIAGGVIGFLFAIFLILLLVYRMRKKDEGSYDLGERKPSSAAYQKAPTKEFYA |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Mouse |
| Gene |
SDC2 |
| Purity |
Protein G purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Flow Cytometry
- Western Blot
|
Packaging, Storage & Formulations
| Storage |
Store at 4C in the dark. |
| Buffer |
PBS (pH 7.4) |
| Preservative |
0.05% Sodium Azide |
| Purity |
Protein G purified |
Alternate Names for Syndecan-2/CD362 Antibody [Biotin]
Background
Proteoglycans are macromolecules consisting of a variety of core proteins with covalently attached one or several polysaccharide chains of the glycosaminoglycan type (heparan sulphate, heparin, chondroitin sulphate, dermatan sulphate or keratan sulphate). At least two forms of basement membrane heparan sulphate proteoglycan (HSPG) have been identified. One with a large core protein (> 400 kD) and one with a small core protein (30 kD). The large HSPG is probably the most abundant basement membrane proteoglycan. It is located predominantly in the lamina lucida, where it forms clustered aggregates and interacts with other basement membrane components to form the matrix. In addition, it also plays a critical role in attachment of cells to the basal membrane via integrin receptors.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: CyTOF-ready, Flow, IHC, IP, KO, Simple Western, WB
Species: Hu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, WB
Species: Hu
Applications: BA
Species: Hu
Applications: CyTOF-ready, Flow, ICC, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Bv, Ca, Eq, Fe, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC, IHC, WB
Species: Hu
Applications: CyTOF-ready, Flow, ICC, WB
Species: Ca, Hu, Mu, Rb, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: ICC, IHC, WB
Species: Hu
Applications: BA
Species: Hu
Applications: IHC, Simple Western, WB
Species: Hu
Applications: IHC, Neut, Simple Western, WB
Species: Hu
Applications: EnzAct
Species: Hu
Applications: BA
Species: Rt
Applications: BA, BA
Species: Hu
Applications: ELISA
Species: Hu
Applications: WB, Flow
Publications for Syndecan-2/CD362 Antibody (H00006383-B04PB) (0)
There are no publications for Syndecan-2/CD362 Antibody (H00006383-B04PB).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Syndecan-2/CD362 Antibody (H00006383-B04PB) (0)
There are no reviews for Syndecan-2/CD362 Antibody (H00006383-B04PB).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Syndecan-2/CD362 Antibody (H00006383-B04PB) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Syndecan-2/CD362 Products
Research Areas for Syndecan-2/CD362 Antibody (H00006383-B04PB)
Find related products by research area.
|
Blogs on Syndecan-2/CD362