Synaptotagmin 13 Antibody

Images

 
Immunohistochemistry-Paraffin: Synaptotagmin 13 Antibody [NBP1-92466] - 1:150 staining dilution of paraffin blocked brain tissue. Antigen retrieval was performed with pH6 citrate buffer. Image submitted by a verified ...read more
Immunohistochemistry-Paraffin: Synaptotagmin 13 Antibody [NBP1-92466] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Synaptotagmin 13 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: TLTLTLRTCDRFSRHSVAGELRLGLDGTSVPLGAAQWGELKTSAKEPSAGAGEVLLSISYLPAANRLLVVLIKAKNLHSNQSKE
Predicted Species
Mouse (96%), Rat (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
SYT13
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Synaptotagmin 13 antibody validated for IHC-P from a verified customer review.
Control Peptide
Synaptotagmin 13 Protein (NBP1-92466PEP)
Reviewed Applications
Read 1 Review rated 5
using
NBP1-92466 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Synaptotagmin 13 Antibody

  • synaptotagmin XIIIKIAA1427synaptotagmin-13
  • sytXIII

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF748
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
NBP1-92466
Species: Hu
Applications: IHC, IHC-P
NB110-60011
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
NBP2-34260
Species: Bv, Hu, Mu, Po, Rb
Applications: ICC/IF, IHC, IHC-P, WB
H00006934-M06
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP2-15840
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
MAB4899
Species: Hu
Applications: IHC
NBP1-83139
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-76944
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB300-750
Species: Fi, Hu, Pm, Mu, Pm, Rt, Sh
Applications: ICC/IF, IHC, IP, WB
AF7237
Species: Hu, Mu, Rt
Applications: ICC, WB
NBP2-13780
Species: Hu, Mu
Applications: IHC, IHC-P
NB600-582
Species: Ca, Ch, SyHa, Ha, Hu, Pm, Mu, Rt
Applications: IHC-Fr, KO, Simple Western, WB
NBP2-46045
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-67331
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-22218
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-81588
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-92466
Species: Hu, Mu, Rt
Applications: IHC, IHC-P

Publications for Synaptotagmin 13 Antibody (NBP1-92466) (0)

There are no publications for Synaptotagmin 13 Antibody (NBP1-92466).
By submitting your publication information earn gift cards and discounts for future purchases.

Review for Synaptotagmin 13 Antibody (NBP1-92466) (1) 51

Average Rating: 5
(Based on 1 review)
We have 1 review tested in 1 species: Human.

Reviews using NBP1-92466:
Filter by Applications
IHC-P
(1)
All Applications
Filter by Species
Human
(1)
All Species
Images Ratings Applications Species Date Details
Immunohistochemistry-Paraffin Synaptotagmin 13 NBP1-92466
Enlarge
5
reviewed by:
Verified Customer
IHC-P Human 09/22/2017
View

Summary

ApplicationImmunohistochemistry-Paraffin
Sample TestedHuman Brain,Paraffin section of human brain
SpeciesHuman
LotR42434

Comments

CommentsAntigen retrieval at pH6, heat-mediated for 20min then 20 min cool-down.
Used at 1:150
Block in Scy-tek Superblock. Hematoxylin to stain nuclei
Used biotinylated secondary antibodies and VectaStain ABC kit and VectaStain NovaRed for signal development.

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for Synaptotagmin 13 Antibody (NBP1-92466) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional Synaptotagmin 13 Products

Bioinformatics Tool for Synaptotagmin 13 Antibody (NBP1-92466)

Discover related pathways, diseases and genes to Synaptotagmin 13 Antibody (NBP1-92466). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Synaptotagmin 13 Antibody (NBP1-92466)

Discover more about diseases related to Synaptotagmin 13 Antibody (NBP1-92466).
 

Pathways for Synaptotagmin 13 Antibody (NBP1-92466)

View related products by pathway.

Research Areas for Synaptotagmin 13 Antibody (NBP1-92466)

Find related products by research area.

Blogs on Synaptotagmin 13

There are no specific blogs for Synaptotagmin 13, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Recent Reviews

5
5
1
4
0
3
0
2
0
1
0

Verified Customer
09/22/2017
Application: IHC-P
Species: Human

Bioinformatics

Gene Symbol SYT13