Synaptotagmin 13 Antibody (1H3) - Azide and BSA Free Summary
| Description |
Novus Biologicals Mouse Synaptotagmin 13 Antibody (1H3) - Azide and BSA Free (H00057586-M04-100ug) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
SYT13 (NP_065877.1, 36 a.a. ~ 135 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. KKGLLPRDQDPDLEKAKPSLLGSAQQFNVKKSTEPVQPRALLKFPDIYGPRPAVTAPEVINYADYSLRSTEEPTAPASPQPPNDSRLKRQVTEELFILPQ |
| Isotype |
IgG2a Kappa |
| Clonality |
Monoclonal |
| Host |
Mouse |
| Gene |
SYT13 |
| Purity |
Protein A or G purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Packaging, Storage & Formulations
| Storage |
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Buffer |
In 1x PBS, pH 7.4 |
| Preservative |
No Preservative |
| Purity |
Protein A or G purified |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Synaptotagmin 13 Antibody (1H3) - Azide and BSA Free
Background
SYT13 belongs to the large synaptotagmin protein family. All synaptotagmins show type I membrane topology, with an extracellular N terminus, a single transmembrane region, and a cytoplasmic C terminus containing tandem C2 domains. Major functions of synaptotagmins include vesicular traffic, exocytosis, and secretion.[supplied by OMIM]
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu
Applications: CyTOF-ready, Dual ISH-IHC, Flow, ICC, IHC, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, IP, Simple Western, WB
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IP, KO, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC, ICFlow, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu
Applications: IHC, IHC-P
Species: Ca, Ch, SyHa, Ha, Hu, Pm, Mu, Rt
Applications: IHC-Fr, KO, Simple Western, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: WB, ELISA
Publications for Synaptotagmin 13 Antibody (H00057586-M04-100ug) (0)
There are no publications for Synaptotagmin 13 Antibody (H00057586-M04-100ug).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for Synaptotagmin 13 Antibody (H00057586-M04-100ug) (0)
There are no reviews for Synaptotagmin 13 Antibody (H00057586-M04-100ug).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for Synaptotagmin 13 Antibody (H00057586-M04-100ug) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional Synaptotagmin 13 Products
Array H00057586-M04-100ug
Research Areas for Synaptotagmin 13 Antibody (H00057586-M04-100ug)
Find related products by research area.
|
Blogs on Synaptotagmin 13