SVIP Antibody


Immunohistochemistry-Paraffin: SVIP Antibody [NBP1-90561] - Staining of human stomach shows strong cytoplasmic and membranous positivity in glandular cells.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

SVIP Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: TPDLEEKRAKLAEAAERRQKEAASRGILDVQSVQEKRKKKEKIEKQIATSGPPPEGGLRWTVS
Specificity of human SVIP antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for SVIP Antibody

  • small VCP/p97-interacting protein


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC-Fr, IP
Species: Hu
Applications: WB, Func, IHC, IHC-P, In vitro
Species: Hu, Mu, Rt, Ca, Mk, Pm
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Ze
Applications: WB, ICC/IF, IHC-Fr, IP
Species: Hu
Applications: WB, IHC, ICC
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-P, PEP-ELISA
Species: Hu, Mu, Ha
Applications: WB, ICC/IF, IHC, IHC-P, KO
Species: Hu
Applications: WB, IHC, ICC
Species: Hu
Applications: WB, IHC, IP
Species: Hu, Mu, Rt, Po, Av, Bv, Ch, Dr, GP, Rb, Sh, Xp, Ze
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB
Species: Hu
Species: Hu
Applications: WB, IHC, IHC-P

Publications for SVIP Antibody (NBP1-90561) (0)

There are no publications for SVIP Antibody (NBP1-90561).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SVIP Antibody (NBP1-90561) (0)

There are no reviews for SVIP Antibody (NBP1-90561). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for SVIP Antibody (NBP1-90561). (Showing 1 - 1 of 1 FAQ).

  1. Would this anti-SVIP rabbit polyclonal antibody NBP1-90561 stain rat tissue as well? Is there a rat species specific antibody available?
    • I ran an alignment on the sequence used and the rat protein and there is about 11 amino acids that don't line up. This is lower than what we would recommend for percent homology and testing with rat, but since this is a polyclonal there is also a large portion of the sequence that remains the same and chances some of the polyclonal antibody will detect there. If you decide to test in rat with this one we cannot guarantee it, but we do have our Innovator's Reward program you could take advantage of. Through this program if you complete an online review with image, detailing your positive or negative results we will send you a discount voucher for 100% of the purchase price of the reviewed product.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional SVIP Products

Array NBP1-90561

Bioinformatics Tool for SVIP Antibody (NBP1-90561)

Discover related pathways, diseases and genes to SVIP Antibody (NBP1-90561). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SVIP Antibody (NBP1-90561)

Discover more about diseases related to SVIP Antibody (NBP1-90561).

Pathways for SVIP Antibody (NBP1-90561)

View related products by pathway.

PTMs for SVIP Antibody (NBP1-90561)

Learn more about PTMs related to SVIP Antibody (NBP1-90561).

Blogs on SVIP

There are no specific blogs for SVIP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our SVIP Antibody and receive a gift card or discount.


Gene Symbol SVIP