SVIP Antibody

Immunohistochemistry-Paraffin: SVIP Antibody [NBP1-90561] - Staining of human stomach shows strong cytoplasmic and membranous positivity in glandular cells.

• Reactivity: Hu
• Applications: IHC, IHC-P
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated

SVIP Antibody Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: TPDLEEKRAKLAEAAERRQKEAASRGILDVQSVQEKRKKKEKIEKQIATSGPPPEGGLRWTVS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SVIP
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  SVIP Protein (NBP1-90561PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for SVIP Antibody

• small VCP/p97-interacting protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

FAQs for SVIP Antibody (NBP1-90561). (Showing 1 - 1 of 1 FAQ).

1. Would this anti-SVIP rabbit polyclonal antibody NBP1-90561 stain rat tissue as well? Is there a rat species specific antibody available?
   • I ran an alignment on the sequence used and the rat protein and there is about 11 amino acids that don't line up. This is lower than what we would recommend for percent homology and testing with rat, but since this is a polyclonal there is also a large portion of the sequence that remains the same and chances some of the polyclonal antibody will detect there. If you decide to test in rat with this one we cannot guarantee it, but we do have our Innovator's Reward program you could take advantage of. Through this program if you complete an online review with image, detailing your positive or negative results we will send you a discount voucher for 100% of the purchase price of the reviewed product.

Bioinformatics

• Gene Symbol: SVIP