SV2A Antibody - BSA Free Summary
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 356-447 of human SV2A (NP_055664.3).
Sequence: ESPRFFLENGKHDEAWMVLKQVHDTNMRAKGHPERVFSVTHIKTIHQEDELIEIQSDTGTWYQRWGVRALSLGGQVWGNFLSCFGPEYRRIT |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
SV2A |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- ELISA
- Western Blot 1:500 - 1:2000
|
| Theoretical MW |
83 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol |
| Preservative |
0.01% Thimerosal |
| Purity |
Affinity purified |
Alternate Names for SV2A Antibody - BSA Free
Background
SV2A (Synaptic Vesicle protein 2A) is an integral membrane glycoproteins present in synaptic vesicles. SV2s have 12 transmembrane domains predicted by sequence analysis. There are three characterized isoforms, SV2A, SV2B and SV2C. SV2A is expressed ubiquitously throughout the brain. SV2B has a more restricted distribution with varying degrees of coexpression with SV2A. SV2C is more closely related to SV2A but shows a very restricted expression pattern. The highest expression levels were observed in phylogenetically old brain areas like pallidum, the midbrain and the olfactory bulb. SV2A is probably involved in the maintenance of a pool of synaptic vesicles competent for calcium-stimulated exocytosis. SV2A is a highly glycosylated synaptic vesicle protein with homology to transmembrane transporters.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Ch, Fe, Hu, Pm, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu, Rt, Ze
Applications: ICC/IF, IHC-WhMt, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu
Applications: IHC, IHC-P
Species: Rt
Applications: ICC, IHC, IP, KO, WB
Species: Hu
Applications: IHC, IHC-P
Species: Ch, Dr, Hu, I, Ma, Mu, Rt
Applications: Dual ISH-IHC, ICC/IF, IHC-FrFl, IHC-WhMt, IHC, IHC-Fr, IHC-P, KO, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu, Pm, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt, RM
Applications: IHC, IHC-Fr, IHC-P
Species: Gp, Hu, Mu, Pm, Rt
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, WB
Species: Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
Species: Hu, Mu, Rb, Rt, Xp
Applications: ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Mu, Rt
Applications: WB, ELISA
Publications for SV2A Antibody (NBP3-35796) (0)
There are no publications for SV2A Antibody (NBP3-35796).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for SV2A Antibody (NBP3-35796) (0)
There are no reviews for SV2A Antibody (NBP3-35796).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for SV2A Antibody (NBP3-35796) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional SV2A Products
Blogs on SV2A