SV2A Antibody - BSA Free

Western Blot: SV2A Antibody [NBP3-35796] - Western blot analysis of various lysates using SV2A Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 1s.

• Reactivity: Mu, Rt
• Applications: WB, ELISA
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SV2A Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SV2A Antibody - BSA Free (NBP3-35796) is a polyclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 356-447 of human SV2A (NP_055664.3).
  
  Sequence:
  ESPRFFLENGKHDEAWMVLKQVHDTNMRAKGHPERVFSVTHIKTIHQEDELIEIQSDTGTWYQRWGVRALSLGGQVWGNFLSCFGPEYRRIT
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SV2A
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 83 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for SV2A Antibody - BSA Free

• KIAA0736
• KIAA0736SV2
• SV2
• SV2A
• synaptic vesicle glycoprotein 2A

Background

SV2A (Synaptic Vesicle protein 2A) is an integral membrane glycoproteins present in synaptic vesicles. SV2s have 12 transmembrane domains predicted by sequence analysis. There are three characterized isoforms, SV2A, SV2B and SV2C. SV2A is expressed ubiquitously throughout the brain. SV2B has a more restricted distribution with varying degrees of coexpression with SV2A. SV2C is more closely related to SV2A but shows a very restricted expression pattern. The highest expression levels were observed in phylogenetically old brain areas like pallidum, the midbrain and the olfactory bulb. SV2A is probably involved in the maintenance of a pool of synaptic vesicles competent for calcium-stimulated exocytosis. SV2A is a highly glycosylated synaptic vesicle protein with homology to transmembrane transporters.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SV2A