SUR-8 Antibody

Images

 
Western Blot: SUR-8 Antibody [NBP2-88383] - Host: Rabbit. Target Name: SHOC2. Antibody Dilution: 1.0ug/ml. Sample Type: Jurkat cell lysate

Product Details

Summary
Reactivity Hu, Rt, Po, Bv, Ca, Eq, Rb, ZeSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

SUR-8 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of SUR-8. Peptide sequence: EKEAKASGGFGKESKEKEPKTKGKDAKDGKKDSSAAQPGVAFSVDNTIKR The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Rat (100%), Porcine (100%), Rabbit (93%), Bovine (100%), Zebrafish (100%), Canine (100%), Equine (100%). Backed by our 100% Guarantee.
Clonality
Polyclonal
Host
Rabbit
Gene
SHOC2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for SUR-8 Antibody

  • KIAA0862FLJ60412
  • Protein soc-2 homolog
  • Protein sur-8 homolog
  • SIAA0862
  • soc-2 (suppressor of clear, C.elegans) homolog
  • soc-2 suppressor of clear homolog (C. elegans)
  • SOC-2
  • SOC2SUR8leucine-rich repeat protein SHOC-2
  • SUR-8

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37513
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready
H00003845-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IP
NBP2-67358
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NB110-68800
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-37454
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP1-47668
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-67791
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP1-82956
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF467
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP1-47842
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, IHC, IHC-P, IP
NBP2-45745
Species: Hu, Mu, Rt, Ca, Pm
Applications: WB, IHC, IHC-P, IF
NBP2-37574
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
AF1638
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
H00055835-M02
Species: Hu
Applications: WB, ELISA, IP, S-ELISA
NBP2-88383
Species: Hu, Rt, Po, Bv, Ca, Eq, Rb, Ze
Applications: WB

Publications for SUR-8 Antibody (NBP2-88383) (0)

There are no publications for SUR-8 Antibody (NBP2-88383).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for SUR-8 Antibody (NBP2-88383) (0)

There are no reviews for SUR-8 Antibody (NBP2-88383). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for SUR-8 Antibody (NBP2-88383) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional SUR-8 Products

Bioinformatics Tool for SUR-8 Antibody (NBP2-88383)

Discover related pathways, diseases and genes to SUR-8 Antibody (NBP2-88383). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for SUR-8 Antibody (NBP2-88383)

Discover more about diseases related to SUR-8 Antibody (NBP2-88383).
 

Pathways for SUR-8 Antibody (NBP2-88383)

View related products by pathway.

PTMs for SUR-8 Antibody (NBP2-88383)

Learn more about PTMs related to SUR-8 Antibody (NBP2-88383).
 

Research Areas for SUR-8 Antibody (NBP2-88383)

Find related products by research area.

Blogs on SUR-8

There are no specific blogs for SUR-8, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our SUR-8 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol SHOC2