SUN1 Antibody - BSA Free

Immunohistochemistry-Paraffin: SUN1 Antibody [NBP1-87395] - Analysis in human skin and bone marrow tissues. Corresponding SUN1 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: SUN1 Antibody [NBP1-87395] - Staining of human fallopian tube, kidney, skin and testis using Anti-SUN1 antibody NBP1-87395 (A) shows similar protein distribution across tissues to independent antibody NBP1-87396 (B).

Western Blot: SUN1 Antibody [NBP1-87395] - Analysis using Anti-SUN1 antibody NBP1-87395 (A) shows similar pattern to independent antibody NBP1-87396 (B).

Immunocytochemistry/Immunofluorescence: SUN1 Antibody [NBP1-87395] - Immunofluorescent staining of human cell line U-2 OS shows localization to nuclear membrane & vesicles.

Immunohistochemistry-Paraffin: SUN1 Antibody [NBP1-87395] - Staining of human testis shows strong positivity in nuclear membrane in Leydig cells.

Immunohistochemistry-Paraffin: SUN1 Antibody [NBP1-87395] - Staining of human bone marrow shows low positivity in hematopoietic cells as expected.

Immunohistochemistry-Paraffin: SUN1 Antibody [NBP1-87395] - Staining of human Fallopian tube shows moderate positivity in nuclear membrane in glandular cells.

Immunohistochemistry-Paraffin: SUN1 Antibody [NBP1-87395] - Staining of human kidney shows strong positivity in nuclear membrane in cells in glomeruli.

Immunohistochemistry-Paraffin: SUN1 Antibody [NBP1-87395] - Staining of human skin shows strong positivity in nuclear membrane in squamous epithelial cells.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

SUN1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit SUN1 Antibody - BSA Free (NBP1-87395) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. Anti-SUN1 Antibody: Cited in 1 publication. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: QGNFFSFLPVLNWASMHRTQRVDDPQDVFKPTTSRLKQPLQGDSEAFPWHWMSGVEQQVASLSGQCHHHGENLRELTTLLQKLQARVDQMEGGAAGPSASVRDAVGQPPRETDFMAFHQEHEVRMSHLEDILGKLR
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SUN1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200 - 1:500
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: ICC/IF reported in scientific literature (PMID: 26356418). For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  SUN1 Protein (NBP1-87395PEP)

Reactivity Notes

Human reactivity reported in scientific literature (PMID: 26356418).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for SUN1 Antibody - BSA Free

• KIAA0810UNC84AFLJ12407
• MGC176649
• Protein unc-84 homolog A
• Sad1 and UNC84 domain containing 1
• Sad1 unc-84 domain protein 1
• Sad1/unc-84 protein-like 1
• SUN domain-containing protein 1
• unc-84 homolog A (C. elegans)
• unc-84 homolog A

Background

This gene is a member of the unc-84 homolog family and encodes a nuclear nuclear envelope protein with an Unc84 (SUN) domain. The protein is involved in nuclear anchorage and migration. Several alternatively spliced transcript variants of this gene have been described; however, the full-length nature of some of these variants has not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for SUN1 Antibody (NBP1-87395)(2)

Publications using NBP1-87395

• Balafouti S, Kabouraki M, Zachos G et al. Tension-sensitive LINC-RhoA signaling prevents chromatin bridge breakage in cytokinesis The EMBO Journal 2025-09-09 [PMID: 40926124]
• Chaumet A, Wright GD, Seet SH et al. Nuclear envelope-associated endosomes deliver surface proteins to the nucleus. Nat Commun 2015-09-10 [PMID: 26356418] (ICC/IF, Human)

FAQs for SUN1 Antibody (NBP1-87395). (Showing 1 - 1 of 1 FAQs).

1. In the third picture on the website, what is the red and what is the green?
   • SUN1 is a nuclear protein, so the green is SUN1 and the red is actin staining to see the cell shape and structure.

Bioinformatics

• Gene Symbol: SUN1