SUMO4 Antibody (1D3) - Azide and BSA Free

Western Blot: SUMO4 Antibody (1D3) [H00387082-M02] - Analysis of SUMO4 expression in transfected 293T cell line by SUMO4 monoclonal antibody (M02), clone 1D3.Lane 1: SUMO4 transfected lysate (Predicted MW: 10.7 KDa).Lane 2: Non-transfected lysate.

Sandwich ELISA: SUMO4 Antibody (1D3) [H00387082-M02] - Detection limit for recombinant GST tagged SUMO4 is 0.1 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 1D3
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

SUMO4 Antibody (1D3) - Azide and BSA Free Summary

• Immunogen: SUMO4 (NP_001002255.1, 1 a.a. ~ 95 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MANEKPTEEVKTENNNHINLKVAGQDGSVVQFKIKRQTPLSKLMKAYCEPRGLSVKQIRFRFGGQPISGTDKPAQLEMEDEDTIDVFQQPTGGVY
• Specificity: This product is specific for Human SUMO4 monoclonal antibody (M02), clone 1D3 [Gene ID: 387082].
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: SUMO4
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
  • Western Blot
• Application Notes: Mouse monoclonal antibody raised against a full-length recombinant SUMO4.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for SUMO4 Antibody (1D3) - Azide and BSA Free

• dJ281H8.4
• IDDM5
• small ubiquitin-like modifier 4 protein
• Small ubiquitin-like protein 4
• small ubiquitin-related modifier 4
• SMT3 suppressor of mif two 3 homolog 2
• SMT3 suppressor of mif two 3 homolog 4 (S. cerevisiae)
• SMT3 suppressor of mif two 3 homolog 4 (yeast)
• SMT3H4
• SUMO4
• SUMO-4

Background

SUMO4 is a member of the SUMO gene family. This family of genes encode small ubiquitin-related modifiers that are attached to proteins and control the target proteins' subcellular localization, stability, or activity. The protein described in this record is located in the cytoplasm and specifically modifies IKBA, leading to negative regulation of NF-kappa-B-dependent transcription of the IL12B gene. A specific polymorphism in this SUMO gene, which leads to the M55V substitution, has been associated with type I diabetes. The RefSeq contains this polymorphism. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SUMO4
• Uniprot:
  • NP_001002255.1(Human)