We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Sulfatase Modifying Factor 1/SUMF1 Recombinant Protein Antigen

Images

 
There are currently no images for Sulfatase Modifying Factor 1/SUMF1 Protein (NBP1-83905PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Sulfatase Modifying Factor 1/SUMF1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SUMF1.

Source: E. coli

Amino Acid Sequence: MDAYEVSNTEFEKFVNSTGYLTEAEKFGDSFVFEGMLSEQVKTNIQQAVAAAPWWLPVKGANWRHPEGPDSTILHR

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
SUMF1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-83905.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Sulfatase Modifying Factor 1/SUMF1 Recombinant Protein Antigen

  • AAPA3037
  • EC 1.8.99.-
  • FGE1
  • FGEC-alpha-formylglycine-generating enzyme 1
  • FGly-generating enzyme
  • MGC131853
  • MGC150436
  • sulfatase modifying factor 1
  • sulfatase-modifying factor 1
  • SUMF1
  • UNQ3037

Background

Sulfatases catalyze the hydrolysis of sulfate esters such as glycosaminoglycans, sulfolipids, and steroid sulfates. C-alpha-formylglycine (FGly), the catalytic residue in the active site of eukaryotic sulfatases, is posttranslationally generated from a cysteine by SUMF1, the FGly-generating enzyme (FGE), in the endoplasmic reticulum (ER). The genetic defect of FGly formation caused by mutations in the SUMF1 gene results in multiple sulfatase deficiency (MSD; MIM 272200), a lysosomal storage disorder (Roeser et al., 2006 [PubMed 16368756]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00347527-P01
Species: Hu
Applications: ELISA, AP, PA, WB
AF3454
Species: Mu
Applications: IP, WB
NBP1-00154
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
NBP1-21398
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP1-32899
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-83164
Species: Hu
Applications: IHC,  IHC-P, WB
H00023071-M01
Species: Hu
Applications: ELISA, IHC,  IHC-P, IP, S-ELISA, WB
NBP2-03381
Species: Ca, Hu, Pm, Mu, Pm, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
H00000439-M03
Species: Hu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, KD, WB
NBP2-48681
Species: Hu
Applications: IHC,  IHC-P
NBP3-32598
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
MAB4415
Species: Hu
Applications: ICC, WB
NBP2-21577
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, IP, KD, WB
H00056731-M02
Species: Hu
Applications: ELISA, ICC/IF, WB
H00007873-M01
Species: Hu
Applications: ELISA, ICC/IF, S-ELISA, WB
NBP2-48658
Species: Hu
Applications: ICC/IF,  IHC-P, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP1-84209
Species: Hu
Applications: ICC/IF, IHC,  IHC-P

Publications for Sulfatase Modifying Factor 1/SUMF1 Protein (NBP1-83905PEP) (0)

There are no publications for Sulfatase Modifying Factor 1/SUMF1 Protein (NBP1-83905PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Sulfatase Modifying Factor 1/SUMF1 Protein (NBP1-83905PEP) (0)

There are no reviews for Sulfatase Modifying Factor 1/SUMF1 Protein (NBP1-83905PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Sulfatase Modifying Factor 1/SUMF1 Protein (NBP1-83905PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Sulfatase Modifying Factor 1/SUMF1 Products

Blogs on Sulfatase Modifying Factor 1/SUMF1

There are no specific blogs for Sulfatase Modifying Factor 1/SUMF1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Sulfatase Modifying Factor 1/SUMF1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol SUMF1