Recombinant Human Sulfatase Modifying Factor 1/SUMF1 Protein

Images

 
SDS-Page: Sulfatase Modifying Factor 1/SUMF1 Partial Recombinant Protein [H00285362-Q01]

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human Sulfatase Modifying Factor 1/SUMF1 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 89-188 of Human Sulfatase Modifying Factor 1/SUMF1

Source: Wheat Germ

Amino Acid Sequence: SKMVPIPAGVFTMGTDDPQIKQDGEAPARRVTIDAFYMDAYEVSNTEFEKFVNSTGYLTEAEKFGDSFVFEGMLSEQVKTNIQQAVAAAPWWLPVKGANW

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
SUMF1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Sulfatase Modifying Factor 1/SUMF1 Protein

  • AAPA3037
  • EC 1.8.99.-
  • FGE1
  • FGEC-alpha-formylglycine-generating enzyme 1
  • FGly-generating enzyme
  • MGC131853
  • MGC150436
  • sulfatase modifying factor 1
  • sulfatase-modifying factor 1
  • SUMF1
  • UNQ3037

Background

Sulfatases catalyze the hydrolysis of sulfate esters such as glycosaminoglycans, sulfolipids, and steroid sulfates. C-alpha-formylglycine (FGly), the catalytic residue in the active site of eukaryotic sulfatases, is posttranslationally generated from a cysteine by SUMF1, the FGly-generating enzyme (FGE), in the endoplasmic reticulum (ER). The genetic defect of FGly formation caused by mutations in the SUMF1 gene results in multiple sulfatase deficiency (MSD; MIM 272200), a lysosomal storage disorder (Roeser et al., 2006 [PubMed 16368756]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00347527-P01
Species: Hu
AF2779
Species: Hu
Applications: WB, IP
NBP1-86135
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-21398
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, IF
NBP1-32899
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83164
Species: Hu
Applications: WB, IHC, IHC-P
H00023071-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, IP
NBP2-03381
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
H00000439-M03
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC-P, RNAi
NBP1-83678
Species: Hu
Applications: IHC, IHC-P
NBP1-59941
Species: Hu
Applications: WB, IHC
MAB4415
Species: Hu
Applications: WB, ICC
NBP2-21577
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, KD
H00056731-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-90099
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-48658
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NBP1-84209
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for Sulfatase Modifying Factor 1/SUMF1 Partial Recombinant Protein (H00285362-Q01) (0)

There are no publications for Sulfatase Modifying Factor 1/SUMF1 Partial Recombinant Protein (H00285362-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Sulfatase Modifying Factor 1/SUMF1 Partial Recombinant Protein (H00285362-Q01) (0)

There are no reviews for Sulfatase Modifying Factor 1/SUMF1 Partial Recombinant Protein (H00285362-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Sulfatase Modifying Factor 1/SUMF1 Partial Recombinant Protein (H00285362-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Sulfatase Modifying Factor 1/SUMF1 Products

Bioinformatics Tool for Sulfatase Modifying Factor 1/SUMF1 Partial Recombinant Protein (H00285362-Q01)

Discover related pathways, diseases and genes to Sulfatase Modifying Factor 1/SUMF1 Partial Recombinant Protein (H00285362-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Sulfatase Modifying Factor 1/SUMF1 Partial Recombinant Protein (H00285362-Q01)

Discover more about diseases related to Sulfatase Modifying Factor 1/SUMF1 Partial Recombinant Protein (H00285362-Q01).
 

Pathways for Sulfatase Modifying Factor 1/SUMF1 Partial Recombinant Protein (H00285362-Q01)

View related products by pathway.

PTMs for Sulfatase Modifying Factor 1/SUMF1 Partial Recombinant Protein (H00285362-Q01)

Learn more about PTMs related to Sulfatase Modifying Factor 1/SUMF1 Partial Recombinant Protein (H00285362-Q01).

Blogs on Sulfatase Modifying Factor 1/SUMF1

There are no specific blogs for Sulfatase Modifying Factor 1/SUMF1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Sulfatase Modifying Factor 1/SUMF1 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol SUMF1
Entrez