Recombinant Human STT3A Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human STT3A Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 603 - 701 of Human ITM1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:GGSTDTGKHIKENDYYTPTGEFRVDREGSPVLLNCLMYKMCYYRFGQVYTEAKRPPGFDRVRNAEIGNKDFELDVLEEAYTTEHWLVRIYKVKDLDNRG

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
STT3A
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human STT3A Protein

  • Integral membrane protein 1EC 2.4.1.119
  • integral transmembrane protein 1
  • ITM1dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A
  • MGC9042
  • Oligosaccharyl transferase subunit STT3A
  • STT3, subunit of the oligosaccharyltransferase complex, homolog A (S.cerevisiae)
  • STT3-AFLJ27038
  • TMCB5
  • transmembrane conserved
  • Transmembrane protein TMC

Background

ITM1 - integral membrane protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-25196
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, In vitro, CyTOF-ready
NBP1-83013
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00728695-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P
NBL1-11228
Species: Hu
NBP1-90306
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-59069
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-230
Species: Hu
Applications: WB, IP, PLA
NBP1-89342
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
NB100-233
Species: Hu
Applications: WB, PLA
NBP2-29931
Species: Hu
Applications: WB, Flow, IHC-P
NBP1-88968
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
MAB140
Species: Hu
Applications: Flow, IHC, CyTOF-ready, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)

Publications for STT3A Partial Recombinant Protein (H00003703-Q01) (0)

There are no publications for STT3A Partial Recombinant Protein (H00003703-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for STT3A Partial Recombinant Protein (H00003703-Q01) (0)

There are no reviews for STT3A Partial Recombinant Protein (H00003703-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for STT3A Partial Recombinant Protein (H00003703-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional STT3A Products

Bioinformatics Tool for STT3A Partial Recombinant Protein (H00003703-Q01)

Discover related pathways, diseases and genes to STT3A Partial Recombinant Protein (H00003703-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for STT3A Partial Recombinant Protein (H00003703-Q01)

Discover more about diseases related to STT3A Partial Recombinant Protein (H00003703-Q01).
 

Pathways for STT3A Partial Recombinant Protein (H00003703-Q01)

View related products by pathway.

PTMs for STT3A Partial Recombinant Protein (H00003703-Q01)

Learn more about PTMs related to STT3A Partial Recombinant Protein (H00003703-Q01).
 

Research Areas for STT3A Partial Recombinant Protein (H00003703-Q01)

Find related products by research area.

Blogs on STT3A

There are no specific blogs for STT3A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

STT3A Antibody (4D4)
H00003703-M02

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human STT3A Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol STT3A