STK36 Antibody

Images

 
Immunohistochemistry-Paraffin: STK36 Antibody [NBP1-83412] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

STK36 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:LLYHPFIAGHVTIITEPAGPDLGTPFTSRLPPELQVLKDEQAHRLAPKGNQSRILTQAYKRMAEEAMQKKHQNTGPALEQEDKTSKVAPGT
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
STK36
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20-1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
STK36 Protein (NBP1-83412PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (82%), Rat (81%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for STK36 Antibody

  • EC 2.7.11
  • EC 2.7.11.1
  • Fused homolog
  • FUserine/threonine kinase 36, fused homolog
  • KIAA1278DKFZp434N0223
  • serine/threonine kinase 36 (fused homolog, Drosophila)
  • serine/threonine kinase 36
  • serine/threonine-protein kinase 36

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34390
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NB600-41532
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
H00001806-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-57016
Species: Hu
Applications: WB
NBP1-26612
Species: Hu
Applications: IP (-), WB
NBP1-92172
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00003077-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-02710
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-22439
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-07799
Species: Hu
NB100-2564
Species: Hu
Applications: WB
NBP2-01743
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF5415
Species: Hu
Applications: WB, IHC, ICC
NBP2-47602
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB600-600
Species: Hu, Mu
Applications: WB, ChIP, ELISA, IHC, IHC-P, Flow-IC
NBP2-24543
Species: Hu, Mu, Pm
Applications: WB, IHC-P
NBP2-55775
Species: Hu
Applications: WB, ICC/IF
NBP2-24543
Species: Hu, Mu, Pm
Applications: WB, IHC-P

Publications for STK36 Antibody (NBP1-83412) (0)

There are no publications for STK36 Antibody (NBP1-83412).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for STK36 Antibody (NBP1-83412) (0)

There are no reviews for STK36 Antibody (NBP1-83412). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for STK36 Antibody (NBP1-83412) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional STK36 Products

Bioinformatics Tool for STK36 Antibody (NBP1-83412)

Discover related pathways, diseases and genes to STK36 Antibody (NBP1-83412). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for STK36 Antibody (NBP1-83412)

Discover more about diseases related to STK36 Antibody (NBP1-83412).
 

Pathways for STK36 Antibody (NBP1-83412)

View related products by pathway.

PTMs for STK36 Antibody (NBP1-83412)

Learn more about PTMs related to STK36 Antibody (NBP1-83412).
 

Research Areas for STK36 Antibody (NBP1-83412)

Find related products by research area.

Blogs on STK36

There are no specific blogs for STK36, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our STK36 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol STK36