STK35 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: STK35 Antibody [NBP2-55292] - Staining of human cell line HaCaT shows localization to nucleus & nuclear bodies.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

STK35 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: TSLKRRHQNVVQFEECVLQRNGLAQRMSHGNKSSQLYLRLVETSLKGERILGYAEEPCYLWF
Specificity
Specificity of human STK35 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (97%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
STK35
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
STK35 Recombinant Protein Antigen (NBP2-55292PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for STK35 Antibody

  • bA550O8.2
  • CLIK-1
  • CLIK1Serine/threonine-protein kinase 35 L1
  • CLP-36 interacting kinase
  • CLP-36-interacting kinase 1
  • EC 2.7.11
  • EC 2.7.11.1
  • PDIK1
  • PDLIM1-interacting kinase 1
  • serine threonine kinase 35 long form
  • serine/threonine kinase 35
  • serine/threonine-protein kinase 35
  • STK35L1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-56732
Species: Hu
Applications: WB
NB200-106
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-51917
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NB600-480
Species: Hu, Mu, Rt, Ca, Ch, Pm
Applications: WB, ELISA, IHC, IHC-P
NBP1-88809
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-31362
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-31308
Species: Hu, Mu, Rt, Bv, Fe
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-61832
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP2-32263
Species: Hu, Mu
Applications: WB, IHC, IP
NBP1-89134
Species: Hu
Applications: IHC, IHC-P
NBP1-89133
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89131
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB110-3638
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NBP1-84843
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-15253
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-55292
Species: Hu, Mu, Rt
Applications: ICC/IF

Publications for STK35 Antibody (NBP2-55292) (0)

There are no publications for STK35 Antibody (NBP2-55292).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for STK35 Antibody (NBP2-55292) (0)

There are no reviews for STK35 Antibody (NBP2-55292). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for STK35 Antibody (NBP2-55292) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional STK35 Products

Bioinformatics Tool for STK35 Antibody (NBP2-55292)

Discover related pathways, diseases and genes to STK35 Antibody (NBP2-55292). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for STK35 Antibody (NBP2-55292)

Discover more about diseases related to STK35 Antibody (NBP2-55292).
 

Pathways for STK35 Antibody (NBP2-55292)

View related products by pathway.

PTMs for STK35 Antibody (NBP2-55292)

Learn more about PTMs related to STK35 Antibody (NBP2-55292).
 

Research Areas for STK35 Antibody (NBP2-55292)

Find related products by research area.

Blogs on STK35

There are no specific blogs for STK35, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our STK35 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol STK35