STG Antibody

Images

 
Immunohistochemistry-Paraffin: STG Antibody [NBP1-90660] - Staining of human cerebellum shows strong nuclear positivity in purkinje cells and cells of molecular layer.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

STG Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:PEDPWQMMAAAAEDRLGEALPEELSYLSSAAALAPGSGPLPGESSPDATGLSPKASLLHQDSESRRLPRSNSLGAGGKILSQRPPWSLIHRVLPDHPWGTLNPSVSWGGGGPGTGWGTRPMPHPEGIWGINNQPPGTSWGNINR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
C6ORF15
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
STG Protein (NBP1-90660PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for STG Antibody

  • chromosome 6 open reading frame 15
  • STG
  • taste bud-specific protein
  • uncharacterized protein C6orf15
  • UNQ1840/PRO3566

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-90095
Species: Hu
Applications: IHC, IHC-P
NBP1-85727
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-37429
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready, ICC
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NBP1-33687
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF3565
Species: Mu
Applications: WB, IHC, IP
NBP2-22411
Species: Rt
Applications: WB, ICC/IF
NBP1-58268
Species: Hu
Applications: WB, IHC, IHC-P
248-BD/CF
Species: Hu, Mu, Rt, Ca, Eq
AF6898
Species: Hu, Mu, Rt
Applications: WB
NBP1-85729
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-1347
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
NBP2-33280
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13943
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-50419
Species: Hu
Applications: Flow, IP, CyTOF-ready
NBP2-34390
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NBP1-90660
Species: Hu
Applications: IHC, IHC-P

Publications for STG Antibody (NBP1-90660) (0)

There are no publications for STG Antibody (NBP1-90660).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for STG Antibody (NBP1-90660) (0)

There are no reviews for STG Antibody (NBP1-90660). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for STG Antibody (NBP1-90660) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional STG Products

STG NBP1-90660

Bioinformatics Tool for STG Antibody (NBP1-90660)

Discover related pathways, diseases and genes to STG Antibody (NBP1-90660). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for STG Antibody (NBP1-90660)

Discover more about diseases related to STG Antibody (NBP1-90660).

Blogs on STG

There are no specific blogs for STG, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our STG Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol C6ORF15