STAT6 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human STAT6. Source: E. coli
Amino Acid Sequence: VYPPHSHSIPPYQGLSPEESVNVLSAFQEPHLQMPPSLGQMSLPFDQPHPQGLLPCQPQEHAVSSPDPLLCSDVTMVEDSCLSQPVTAFPQGTWIGEDIFPPLLPPTEQDLTKLLLEGQGESGGGSLGAQPLLQPSHYGQSGISMSHMDLR Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
STAT6 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-85345. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
34 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for STAT6 Recombinant Protein Antigen
Background
Signal Transducer and Activator of Transcription 6 (STAT6) is a member of the Janus family tyrosine kinases (Jak)/ STAT signal transduction pathway and mediates cytokine signaling by IL 4 and IL-13 (1). STAT6 (predicted molecular weight 94kDa) has been found to induce the expression of BCL2L1/BCL-X(L), which is responsible for the anti-apoptotic activity of IL-4. In response to cytokines and growth factors, STAT family members are phosphorylated by the receptor associated kinases, and then form homo- or heterodimers that translocate to the cell nucleus where they act as transcription activators. STAT6 is tyrosine phosphorylated (Tyr641) in response to cellular interaction with IL-4. STAT6 mRNA has been detected in peripheral blood lymphocytes, colon, intestine, ovary, prostate, thymus, spleen, kidney, liver, lung and placenta. STAT6 is critically involved in Th2 and Th9 immune response (2). Loss of STAT6 impairs IL-4 mediated functions including Th2 helper T cell differentiation, expression of cell surface markers, T-cell proliferation, immunoglobulin class switching to IgE, and partial loss of IL-4 mediated proliferation. Diseases associated with STAT6 include malignant hemangiopericytoma and nut allergies.
References
1. Waqas, S. F. H., Ampem, G., & Roszer, T. (2019). Analysis of IL-4/STAT6 Signaling in Macrophages. Methods Mol Biol, 1966, 211-224. doi:10.1007/978-1-4939-9195-2_17
2. Goenka, S., & Kaplan, M. H. (2011). Transcriptional regulation by STAT6. Immunol Res, 50(1), 87-96. doi:10.1007/s12026-011-8205-2
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Mu
Applications: ELISA
Species: Ha, Hu, Mu
Applications: ICC/IF, IP, WB
Species: Mu
Applications: BA
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: CyTOF-ready, ICFlow, Simple Western, WB
Species: Ca, Hu, Mu, Po, Rb, Rt
Applications: Dual ISH-IHC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, Simple Western, WB
Species: Hu, Mu
Applications: ChIP, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC, IP, ICFlow, KO, WB
Species: Hu
Applications: Flow-CS, Flow-IC, Flow, IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu
Applications: CyTOF-ready, ICC, IP, ICFlow, KO, Simple Western, WB
Species: Mu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, Flow, ICC/IF, MiAr, Simple Western, WB
Species: Mu
Applications: ELISA
Species: Ch, Mu
Applications: ELISA, IHC, Single-Cell Western, WB
Species: Hu, Rb, Rt
Applications: Flow, IHC, IHC-P, KO, Simple Western, WB
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, WB
Publications for STAT6 Recombinant Protein Antigen (NBP1-85345PEP) (0)
There are no publications for STAT6 Recombinant Protein Antigen (NBP1-85345PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for STAT6 Recombinant Protein Antigen (NBP1-85345PEP) (0)
There are no reviews for STAT6 Recombinant Protein Antigen (NBP1-85345PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for STAT6 Recombinant Protein Antigen (NBP1-85345PEP) (0)