STAT2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: STAT2 Antibody [NBP1-86991] - Staining of human cell line A-431 shows positivity in plasma membrane and cytoplasm.
Immunohistochemistry-Paraffin: STAT2 Antibody [NBP1-86991] - Staining of human urinary bladder shows strong cytoplasmic positivity in urothelial cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

STAT2 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:DPTQLAEMIFNLLLEEKRILIQAQRAQLEQGEPVLETPVESQQHEIESRILDLRAMMEKLVKSISQLKDQQDVFCFRYKIQAKGKTPSLDPHQTKEQKILQETLNELDKRRKEVLDASKALLGRLTTLIELLLPKL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
STAT2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
STAT2 Protein (NBP1-86991PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for STAT2 Antibody

  • interferon alpha induced transcriptional activator
  • ISGF-3
  • MGC59816
  • P113
  • signal transducer and activator of transcription 2
  • signal transducer and activator of transcription 2, 113kD
  • signal transducer and activator of transcription 2, 113kDa
  • STAT113
  • STAT2

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2894
Species: Hu, Mu
Applications: WB, Simple Western, CyTOF-ready, ICFlow
AF5629
Species: Hu, Mu
Applications: WB
MAB4260
Species: Hu, Mu, Rt
Applications: WB, IHC, CyTOF-ready, ICC, ICFlow
NB400-141
Species: Hu, Mu, Ha
Applications: WB, ICC/IF, IP
NBP2-22471
Species: Hu, Mu, Rt, Mk, Pm
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP
AF2988
Species: Mu, Rt
Applications: WB
H00007297-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC-P, IP
AF4715
Species: Mu
Applications: WB
NBP2-00622
Species: Hu, Rt, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF1584
Species: Hu, Mu
Applications: WB, Simple Western, IP, CyTOF-ready, ICC, ICFlow
NBP2-00851
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-84382
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-2813
Species: Hu, Mu, Ch, Rb
Applications: WB, ICC/IF, IP
AF245
Species: Hu
Applications: WB, Flow, CyTOF-ready
NBP2-25241
Species: Hu, Mu
Applications: WB, ICC/IF, IP

Publications for STAT2 Antibody (NBP1-86991) (0)

There are no publications for STAT2 Antibody (NBP1-86991).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for STAT2 Antibody (NBP1-86991) (0)

There are no reviews for STAT2 Antibody (NBP1-86991). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for STAT2 Antibody (NBP1-86991) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional STAT2 Products

Bioinformatics Tool for STAT2 Antibody (NBP1-86991)

Discover related pathways, diseases and genes to STAT2 Antibody (NBP1-86991). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for STAT2 Antibody (NBP1-86991)

Discover more about diseases related to STAT2 Antibody (NBP1-86991).
 

Pathways for STAT2 Antibody (NBP1-86991)

View related products by pathway.

PTMs for STAT2 Antibody (NBP1-86991)

Learn more about PTMs related to STAT2 Antibody (NBP1-86991).
 

Research Areas for STAT2 Antibody (NBP1-86991)

Find related products by research area.

Blogs on STAT2

There are no specific blogs for STAT2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our STAT2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol STAT2
Entrez