START domain containing 7 Recombinant Protein Antigen Summary
Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human START domain containing 7. Source: E. coli Amino Acid Sequence: VIRPHKSFDENGFDYLLTYSDNPQTVFPRYCVSWMVSSGMPDFLEKLHMATLKAKNMEIKVKDYISAKPLEMSSEAKATSQSSERKNE Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
Source |
E. coli |
Protein/Peptide Type |
Recombinant Protein Antigen |
Gene |
STARD7 |
Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
Dilutions |
- Antibody Competition 10 - 100 molar excess
|
Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57423. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
Theoretical MW |
28 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS and 1M Urea, pH 7.4. |
Preservative |
No Preservative |
Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for START domain containing 7 Recombinant Protein Antigen
Background
Although the function of this gene is not known, its existence is supported by mRNA and EST data. The predicted gene product contains a region similar to the STAR-related lipid transfer (START) domain, which is often present in proteins involved in the cell signaling mediated by lipid binding. Two alternatively spliced transcript variants that encode an identical protein have been reported.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: ELISA, KD, S-ELISA, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KO, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P
Species: Mu
Applications: WB
Species: Hu, Pm, Mu, Rb, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu
Applications: ELISA, IHC, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, Simple Western, WB
Species: Hu, Mu, Pm
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ChIP, CyTOF-ready, ICC, IHC, ICFlow, Simple Western, WB
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), IHC, IP, WB
Species: Hu
Applications: IHC, Simple Western, WB
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: AC
Publications for START domain containing 7 Recombinant Protein Antigen (NBP2-57423PEP) (0)
There are no publications for START domain containing 7 Recombinant Protein Antigen (NBP2-57423PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for START domain containing 7 Recombinant Protein Antigen (NBP2-57423PEP) (0)
There are no reviews for START domain containing 7 Recombinant Protein Antigen (NBP2-57423PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for START domain containing 7 Recombinant Protein Antigen (NBP2-57423PEP) (0)
Additional START domain containing 7 Products
Blogs on START domain containing 7