STARD8 Antibody

Images

 
Immunohistochemistry: STARD8 Antibody [NBP2-32567] - placenta
Immunohistochemistry: STARD8 Antibody [NBP2-32567] - Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
Immunohistochemistry: STARD8 Antibody [NBP2-32567] - placenta
Immunohistochemistry: STARD8 Antibody [NBP2-32567] - liver cancer
Immunohistochemistry: STARD8 Antibody [NBP2-32567] - Immunohistochemical staining of human kidney shows strong cytoplasmic positivity in cells in tubules.
Immunohistochemistry: STARD8 Antibody [NBP2-32567] - liver cancer

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit

Order Details

STARD8 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: PAQDSEQEAHSGGEPTFASSLSVEEGHSISDTVASSSELDSSGNSMNEAEAAGPLAGLQASMPRERRDSGV
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
STARD8
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Control Peptide
STARD8 Protein (NBP2-32567PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (80%)

Alternate Names for STARD8 Antibody

  • ARHGAP38
  • Deleted in liver cancer 3 protein
  • DKFZp686H1668
  • DLC3DLC-3
  • KIAA0189stAR-related lipid transfer protein 8
  • StARD8
  • StAR-related lipid transfer (START) domain containing 8
  • START domain containing 8
  • START domain-containing protein 8
  • STARTGAP3
  • START-GAP3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB300-917
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
AF877
Species: Hu
Applications: WB, IHC, IP
NBP1-85724
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88831
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87399
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00140735-M04
Species: Hu
Applications: WB, ELISA
NBP1-83870
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-38235
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90108
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-46290
Species: Hu
Applications: WB, IHC, IF
NBP1-88830
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00057522-M03
Species: Hu, Mu
Applications: WB, ELISA, IHC, IHC-P
NBP2-15454
Species: Hu
Applications: WB, IHC, IHC-P
AF482
Species: Mu
Applications: WB, IHC
NBP2-38132
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NBP1-91678
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P

Publications for STARD8 Antibody (NBP2-32567) (0)

There are no publications for STARD8 Antibody (NBP2-32567).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for STARD8 Antibody (NBP2-32567) (0)

There are no reviews for STARD8 Antibody (NBP2-32567). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for STARD8 Antibody (NBP2-32567) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional STARD8 Antibody Products

Related Products by Gene

Bioinformatics Tool for STARD8 Antibody (NBP2-32567)

Discover related pathways, diseases and genes to STARD8 Antibody (NBP2-32567). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for STARD8 Antibody (NBP2-32567)

Discover more about diseases related to STARD8 Antibody (NBP2-32567).
 

Pathways for STARD8 Antibody (NBP2-32567)

View related products by pathway.

PTMs for STARD8 Antibody (NBP2-32567)

Learn more about PTMs related to STARD8 Antibody (NBP2-32567).

Blogs on STARD8

There are no specific blogs for STARD8, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol STARD8

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on NBP2-32567 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought