STARD3NL Antibody - Azide and BSA Free

Western Blot: STARD3NL Antibody [NBP2-94673] - Western blot analysis of extracts of various cell lines, using STARD3NL antibody (NBP2-94673) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 30s.

Immunohistochemistry-Paraffin: STARD3NL Antibody [NBP2-94673] - Immunohistochemistry of paraffin-embedded Rat brain using STARD3NL Rabbit pAb (NBP2-94673) at dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry-Paraffin: STARD3NL Antibody [NBP2-94673] - Immunohistochemistry of paraffin-embedded Human colon carcinoma using STARD3NL Rabbit pAb (NBP2-94673) at dilution of 1:100 (40x lens). Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

STARD3NL Antibody - Azide and BSA Free Summary

• Description: Novus Biologicals Rabbit STARD3NL Antibody - Azide and BSA Free (NBP2-94673) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 185-234 of human STARD3NL (NP_114405.1). RLLIVQDASERAALIPGGLSDGQFYSPPESEAGSEEAEEKQDSEKPLLEL
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: STARD3NL
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50-1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for STARD3NL Antibody - Azide and BSA Free

• MLN64 N-terminal domain homolog
• STARD3 N-terminal like

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: STARD3NL