STAMP2/STEAP4 Recombinant Protein Antigen

Images

 
There are currently no images for STAMP2/STEAP4 Recombinant Protein Antigen (NBP3-17940PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

STAMP2/STEAP4 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human STAMP2/STEAP4

Source: E. coli

Amino Acid Sequence: TCIDALPLTMNSSEKQETVCIFGTGDFGRSLGLKMLQCGYSVVFGSRNPQKTTLLPSGAEVLSYSEAAKKSDIIIIAIHREHY

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
STEAP4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17940.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for STAMP2/STEAP4 Recombinant Protein Antigen

  • EC 1.16.1
  • EC 1.16.1.-
  • FLJ23153
  • Six-transmembrane epithelial antigen of prostate 4
  • SixTransMembrane protein of prostate 2
  • STAMP2
  • STAMP2DKFZp666D049
  • STEAP family member 4
  • STEAP4
  • TIARP
  • TIARPsix transmembrane prostate protein 2
  • TNFAIP9
  • Tumor necrosis factor, alpha-induced protein 9metalloreductase STEAP4
  • tumor necrosis-alpha-induced adipose-related protein

Background

STEAP4 is a member of a family of metalloreductases identified as cell-surface antigens in prostate tissue. It is similar to two other members of the STEAP family, STEAP2 and STEAP3. STEAP4 promotes the reduction of both iron (Fe3+ to Fe2+) and copper (Cu2+ to Cu1+). STEAP4 is highly expressed in placenta, lung, heart and prostate tissues. Furthermore, it is over expressed in prostate cancer cells compared to normal prostate cells. STEAP4 may have a role in cell proliferation and prostrate cancer progression since over expression of STEAP4 in prostate cells significantly increases cell growth and colony formation. At least two isoforms of this protein are known to exist.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
M6000B
Species: Mu
Applications: ELISA
NBP1-49533
Species: Hu, Mu, Pl, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC,  IHC-P, KD, WB
NBP2-02541
Species: Hu, Pm, Mu, Pm, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-48437
Species: Hu
Applications: Flow-IC, ICC/IF, IHC,  IHC-P, WB
NBP2-59451
Species: Hu
Applications: ELISA, Flow, ICC/IF, MiAr, Simple Western, WB
NBP2-24653
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP1-30914
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IM, WB
NBP1-76823
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
AF4928
Species: Hu
Applications: CyTOF-ready, Flow, WB
NB100-56603
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC,  IHC-P, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
DRP300
Species: Hu
Applications: ELISA
NB100-82001
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC,  IHC-P, Simple Western, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
H00006223-M01
Species: Hu, Mu
Applications: ELISA, WB
H00005706-M02
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, KD, WB

Publications for STAMP2/STEAP4 Recombinant Protein Antigen (NBP3-17940PEP) (0)

There are no publications for STAMP2/STEAP4 Recombinant Protein Antigen (NBP3-17940PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for STAMP2/STEAP4 Recombinant Protein Antigen (NBP3-17940PEP) (0)

There are no reviews for STAMP2/STEAP4 Recombinant Protein Antigen (NBP3-17940PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for STAMP2/STEAP4 Recombinant Protein Antigen (NBP3-17940PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional STAMP2/STEAP4 Products

Research Areas for STAMP2/STEAP4 Recombinant Protein Antigen (NBP3-17940PEP)

Find related products by research area.

Blogs on STAMP2/STEAP4

There are no specific blogs for STAMP2/STEAP4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our STAMP2/STEAP4 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol STEAP4