STAMP2/STEAP4 Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human STAMP2/STEAP4 Source: E. coli
Amino Acid Sequence: TCIDALPLTMNSSEKQETVCIFGTGDFGRSLGLKMLQCGYSVVFGSRNPQKTTLLPSGAEVLSYSEAAKKSDIIIIAIHREHY Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
STEAP4 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10-100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17940. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
27 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for STAMP2/STEAP4 Recombinant Protein Antigen
Background
STEAP4 is a member of a family of metalloreductases identified as cell-surface antigens in prostate tissue. It is similar to two other members of the STEAP family, STEAP2 and STEAP3. STEAP4 promotes the reduction of both iron (Fe3+ to Fe2+) and copper (Cu2+ to Cu1+). STEAP4 is highly expressed in placenta, lung, heart and prostate tissues. Furthermore, it is over expressed in prostate cancer cells compared to normal prostate cells. STEAP4 may have a role in cell proliferation and prostrate cancer progression since over expression of STEAP4 in prostate cells significantly increases cell growth and colony formation. At least two isoforms of this protein are known to exist.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu
Applications: BA
Species: Bv, Hu, Mu
Applications: ICC, IHC
Species: Mu
Applications: ELISA
Species: Hu, Mu, Pl, Rt
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, KD, WB
Species: Hu, Pm, Mu, Pm, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: Flow-IC, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, Flow, ICC/IF, MiAr, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IM, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Flow, WB
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu, Mu
Applications: ELISA, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, KD, WB
Publications for STAMP2/STEAP4 Recombinant Protein Antigen (NBP3-17940PEP) (0)
There are no publications for STAMP2/STEAP4 Recombinant Protein Antigen (NBP3-17940PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for STAMP2/STEAP4 Recombinant Protein Antigen (NBP3-17940PEP) (0)
There are no reviews for STAMP2/STEAP4 Recombinant Protein Antigen (NBP3-17940PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for STAMP2/STEAP4 Recombinant Protein Antigen (NBP3-17940PEP) (0)
Additional STAMP2/STEAP4 Products
Research Areas for STAMP2/STEAP4 Recombinant Protein Antigen (NBP3-17940PEP)
Find related products by research area.
|
Blogs on STAMP2/STEAP4