STAMP2/STEAP4 Recombinant Protein Antigen

Images

 
There are currently no images for STAMP2/STEAP4 Recombinant Protein Antigen (NBP2-56536PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

STAMP2/STEAP4 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human STAMP2/STEAP4.

Source: E.coli

Amino Acid Sequence: IRYYVRWRLGNLTVTQAILKKENPFSTSSAWLSD

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
STEAP4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-56536 The protein was purified by IMAC chromatography and the expected concentration is greater than 0.5 mg/ml. This protein is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related information and a protocol, click here.
Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for STAMP2/STEAP4 Recombinant Protein Antigen

  • EC 1.16.1
  • EC 1.16.1.-
  • FLJ23153
  • Six-transmembrane epithelial antigen of prostate 4
  • SixTransMembrane protein of prostate 2
  • STAMP2
  • STAMP2DKFZp666D049
  • STEAP family member 4
  • STEAP4
  • TIARP
  • TIARPsix transmembrane prostate protein 2
  • TNFAIP9
  • Tumor necrosis factor, alpha-induced protein 9metalloreductase STEAP4
  • tumor necrosis-alpha-induced adipose-related protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-49533
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, Flow-IC
NBP2-02541
Species: Hu, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-07094
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, PAGE
NBP2-67429
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-24557
Species: Hu, Eq, Pm
Applications: WB, IHC-P
NBP1-30914
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-76823
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF4928
Species: Hu
Applications: WB, Flow, CyTOF-ready
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
AF3978
Species: Hu, Mu, Rt
Applications: WB, IHC
H00006223-M01
Species: Hu
Applications: WB, ELISA
H00005706-M02
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, RNAi
MAB208
Species: Hu
Applications: WB, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ICFlow, Neut, ELISA(Sta)

Publications for STAMP2/STEAP4 Recombinant Protein Antigen (NBP2-56536PEP) (0)

There are no publications for STAMP2/STEAP4 Recombinant Protein Antigen (NBP2-56536PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for STAMP2/STEAP4 Recombinant Protein Antigen (NBP2-56536PEP) (0)

There are no reviews for STAMP2/STEAP4 Recombinant Protein Antigen (NBP2-56536PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for STAMP2/STEAP4 Recombinant Protein Antigen (NBP2-56536PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for STAMP2/STEAP4 Recombinant Protein Antigen (NBP2-56536PEP)

Discover related pathways, diseases and genes to STAMP2/STEAP4 Recombinant Protein Antigen (NBP2-56536PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for STAMP2/STEAP4 Recombinant Protein Antigen (NBP2-56536PEP)

Discover more about diseases related to STAMP2/STEAP4 Recombinant Protein Antigen (NBP2-56536PEP).
 

Pathways for STAMP2/STEAP4 Recombinant Protein Antigen (NBP2-56536PEP)

View related products by pathway.

PTMs for STAMP2/STEAP4 Recombinant Protein Antigen (NBP2-56536PEP)

Learn more about PTMs related to STAMP2/STEAP4 Recombinant Protein Antigen (NBP2-56536PEP).

Blogs on STAMP2/STEAP4

There are no specific blogs for STAMP2/STEAP4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our STAMP2/STEAP4 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol STEAP4
Entrez