ST8 alpha-2,8-Sialyltransferase 8B/ST8SIA2 Antibody


Western Blot: ST8 alpha-2,8-Sialyltransferase 8B/ST8SIA2 Antibody [NBP1-69280] - This Anti-ST8SIA2 antibody was used in Western Blot of HepG2 tissue lysate at a concentration of 1ug/ml.
Immunohistochemistry: ST8 alpha-2,8-Sialyltransferase 8B/ST8SIA2 Antibody [NBP1-69280] - Staining of human kidney.

Product Details

Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P

Order Details

ST8 alpha-2,8-Sialyltransferase 8B/ST8SIA2 Antibody Summary

Synthetic peptides corresponding to ST8SIA2(ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 2) The peptide sequence was selected from the C terminal of ST8SIA2. Peptide sequence TGLLMYTLATRFCKQIYLYGFWPFPLDQNQNPVKYHYYDSLKYGYTSQAS
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:10-1:500
Theoretical MW
42 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ST8 alpha-2,8-Sialyltransferase 8B/ST8SIA2 Antibody

  • alpha-2,8-sialyltransferase 8B 1
  • alpha-2,8-sialyltransferase 8B
  • EC 2.4.99
  • EC 2.4.99.-
  • HsT19690
  • MGC116854
  • MGC116857
  • sialyltransferase 8 (alpha-2, 8-sialytransferase) B
  • Sialyltransferase 8B
  • Sialyltransferase X
  • Sialytransferase St8Sia II
  • SIAT8B
  • SIAT8-B
  • ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 2
  • ST8SIA2
  • ST8SiaII
  • STX


ST8SIA2 is a type II membrane protein that is thought to catalyze the transfer of sialic acid from CMP-sialic acid to N-linked oligosaccharides and glycoproteins. ST8SIA2 may be found in the Golgi apparatus and may be involved in the production of polysialic acid, a modulator of the adhesive properties of neural cell adhesion molecule (NCAM1). This protein is a member of glycosyltransferase family 29The protein encoded by this gene is a type II membrane protein that is thought to catalyze the transfer of sialic acid from CMP-sialic acid to N-linked oligosaccharides and glycoproteins. The encoded protein may be found in the Golgi apparatus and may be involved in the production of polysialic acid, a modulator of the adhesive properties of neural cell adhesion molecule (NCAM1). This protein is a member of glycosyltransferase family 29.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Mu
Applications: WB, IHC
Species: Hu, Mu, Rt
Applications: WB, ICC
Species: Hu, Mu
Applications: WB, Flow, IHC-P
Species: Hu
Applications: WB, ELISA, Flow, IHC-P, IP
Species: Hu, Rt, Ze
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, Simple Western
Species: Hu
Applications: WB, ELISA, IHC
Species: Hu
Applications: WB
Species: Hu
Applications: WB, IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready

Publications for ST8 alpha-2,8-Sialyltransferase 8B/ST8SIA2 Antibody (NBP1-69280) (0)

There are no publications for ST8 alpha-2,8-Sialyltransferase 8B/ST8SIA2 Antibody (NBP1-69280).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ST8 alpha-2,8-Sialyltransferase 8B/ST8SIA2 Antibody (NBP1-69280) (0)

There are no reviews for ST8 alpha-2,8-Sialyltransferase 8B/ST8SIA2 Antibody (NBP1-69280). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ST8 alpha-2,8-Sialyltransferase 8B/ST8SIA2 Antibody (NBP1-69280) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ST8 alpha-2,8-Sialyltransferase 8B/ST8SIA2 Products

Bioinformatics Tool for ST8 alpha-2,8-Sialyltransferase 8B/ST8SIA2 Antibody (NBP1-69280)

Discover related pathways, diseases and genes to ST8 alpha-2,8-Sialyltransferase 8B/ST8SIA2 Antibody (NBP1-69280). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ST8 alpha-2,8-Sialyltransferase 8B/ST8SIA2 Antibody (NBP1-69280)

Discover more about diseases related to ST8 alpha-2,8-Sialyltransferase 8B/ST8SIA2 Antibody (NBP1-69280).

Pathways for ST8 alpha-2,8-Sialyltransferase 8B/ST8SIA2 Antibody (NBP1-69280)

View related products by pathway.

PTMs for ST8 alpha-2,8-Sialyltransferase 8B/ST8SIA2 Antibody (NBP1-69280)

Learn more about PTMs related to ST8 alpha-2,8-Sialyltransferase 8B/ST8SIA2 Antibody (NBP1-69280).

Research Areas for ST8 alpha-2,8-Sialyltransferase 8B/ST8SIA2 Antibody (NBP1-69280)

Find related products by research area.

Blogs on ST8 alpha-2,8-Sialyltransferase 8B/ST8SIA2

There are no specific blogs for ST8 alpha-2,8-Sialyltransferase 8B/ST8SIA2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ST8 alpha-2,8-Sialyltransferase 8B/ST8SIA2 Antibody and receive a gift card or discount.


Gene Symbol ST8SIA2