Recombinant Human ST8 alpha-2,8-Sialyltransferase 8A/ST8SIA1/Ganglioside GD3 Protein Summary
| Description |
A recombinant protein with a N-terminal GST tag corresponding to the amino acids 61-160 of Human ST8SIA1 partial ORF Source: Wheat Germ (in vitro) Amino Acid Sequence:VLQQGTAWRRNQTAARAFRKQMEDCCDPAHLFAMTKMNSPMGKSMWYDGEFLYSFTIDNSTYSLFPQATPFQLPLKKCAVVGNGGILKKSGCGRQIDEAN |
Preparation Method |
in vitro wheat germ expression system |
| Protein/Peptide Type |
Partial Recombinant Protein |
| Gene |
ST8SIA1 |
Applications/Dilutions
| Dilutions |
- ELISA
- Immunoaffinity Purification
- Protein Array
- Western Blot
|
| Application Notes |
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells. |
Reactivity Notes
Packaging, Storage & Formulations
| Storage |
Store at -80C. Avoid freeze-thaw cycles. |
| Buffer |
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer. |
Notes
This product is produced by and distributed for Abnova, a company based in Taiwan.
Alternate Names for Recombinant Human ST8 alpha-2,8-Sialyltransferase 8A/ST8SIA1/Ganglioside GD3 Protein
Background
ST8SIA1 - ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 1
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Pm, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, IP, WB
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu, Mu, Rt
Applications: ICC, IHC, Simple Western, WB
Species: Hu, Mu
Applications: ICC/IF, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: BA
Species: Hu
Applications: Block, CyTOF-ready, Flow, ICC, IHC, KO, Simple Western, WB
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: BA
Species: Pm, Hu, Pm, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC, Simple Western, WB
Species: Hu
Applications: BA
Publications for ST8 alpha-2,8-Sialyltransferase 8A/ST8SIA1/Ganglioside GD3 Partial Recombinant Protein (H00006489-Q01) (0)
There are no publications for ST8 alpha-2,8-Sialyltransferase 8A/ST8SIA1/Ganglioside GD3 Partial Recombinant Protein (H00006489-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for ST8 alpha-2,8-Sialyltransferase 8A/ST8SIA1/Ganglioside GD3 Partial Recombinant Protein (H00006489-Q01) (0)
There are no reviews for ST8 alpha-2,8-Sialyltransferase 8A/ST8SIA1/Ganglioside GD3 Partial Recombinant Protein (H00006489-Q01).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for ST8 alpha-2,8-Sialyltransferase 8A/ST8SIA1/Ganglioside GD3 Partial Recombinant Protein (H00006489-Q01) (0)
Additional ST8 alpha-2,8-Sialyltransferase 8A/ST8SIA1/Ganglioside GD3 Products
Research Areas for ST8 alpha-2,8-Sialyltransferase 8A/ST8SIA1/Ganglioside GD3 Partial Recombinant Protein (H00006489-Q01)
Find related products by research area.
|
Blogs on ST8 alpha-2,8-Sialyltransferase 8A/ST8SIA1/Ganglioside GD3