ST8 alpha-2,8-Sialyltransferase 8A/ST8SIA1/Ganglioside GD3 Antibody

Images

 
Western Blot: ST8 alpha-2,8-Sialyltransferase 8A/ST8SIA1/Ganglioside GD3 Antibody [NBP1-80750] - Analysis in control (vector only transfected HEK293T lysate) and sT8SIA1 over-expression lysate (Co-expressed with a ...read more
Immunohistochemistry-Paraffin: ST8 alpha-2,8-Sialyltransferase 8A/ST8SIA1/Ganglioside GD3 Antibody [NBP1-80750] - Staining of human small intestine shows moderate cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ST8 alpha-2,8-Sialyltransferase 8A/ST8SIA1/Ganglioside GD3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RLPNEKEIVQGVLQQGTAWRRNQTAARAFRKQMEDCCDPAHLFAMTKMNSPMGKSMWYDGEFLYSFTIDNSTYSLFPQATPFQLPLKKCAVVGNGGILKKSGCGRQIDEANFVMRC
Specificity
Specificity of human ST8 alpha-2,8-Sialyltransferase 8A/ST8SIA1/Ganglioside GD3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (91%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ST8SIA1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 0.4 ug/ml
  • Immunohistochemistry 1:200 - 1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ST8 alpha-2,8-Sialyltransferase 8A/ST8SIA1/Ganglioside GD3 Protein (NBP1-80750PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ST8 alpha-2,8-Sialyltransferase 8A/ST8SIA1/Ganglioside GD3 Antibody

  • Alpha-2,8-sialyltransferase 8A
  • alpha-N-acetylneuraminide alpha-2,8-sialyltransferase
  • disialoganglioside (GD3) synthase
  • Ganglioside GD3 synthase
  • Ganglioside GT3 synthase
  • ganglioside-specific alpha-2,8-polysialyltransferase
  • GD3 synthase)
  • GD3S
  • sialyltransferase 8 (alpha-N-acetylneuraminate: alpha-2,8-sialytransferase, GD3synthase) A
  • sialyltransferase 8A (alpha-N-acetylneuraminate: alpha-2,8-sialyltransferase
  • Sialyltransferase 8A
  • Sialytransferase St8Sia I
  • SIAT8A
  • SIAT8-A
  • SIAT8EC 2.4.99.8
  • ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 1
  • ST8SIA1
  • ST8SiaI

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NB300-749
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-13075
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP, IHC-FrFl
AF1347
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NB100-2911
Species: Hu
Applications: WB, ICC/IF
NBP1-62245
Species: Hu
Applications: WB
NBP2-20492
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-81621
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-15533
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC

Publications for ST8 alpha-2,8-Sialyltransferase 8A/ST8SIA1/Ganglioside GD3 Antibody (NBP1-80750) (0)

There are no publications for ST8 alpha-2,8-Sialyltransferase 8A/ST8SIA1/Ganglioside GD3 Antibody (NBP1-80750).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ST8 alpha-2,8-Sialyltransferase 8A/ST8SIA1/Ganglioside GD3 Antibody (NBP1-80750) (0)

There are no reviews for ST8 alpha-2,8-Sialyltransferase 8A/ST8SIA1/Ganglioside GD3 Antibody (NBP1-80750). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ST8 alpha-2,8-Sialyltransferase 8A/ST8SIA1/Ganglioside GD3 Antibody (NBP1-80750). (Showing 1 - 1 of 1 FAQ).

  1. Can you please provide the concentration for NBP1-80750, Lot A74021?
    • I can confirm that lot number A74021 is supplied at 0.1mg/ml.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for ST8 alpha-2,8-Sialyltransferase 8A/ST8SIA1/Ganglioside GD3 Antibody (NBP1-80750)

Discover related pathways, diseases and genes to ST8 alpha-2,8-Sialyltransferase 8A/ST8SIA1/Ganglioside GD3 Antibody (NBP1-80750). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ST8 alpha-2,8-Sialyltransferase 8A/ST8SIA1/Ganglioside GD3 Antibody (NBP1-80750)

Discover more about diseases related to ST8 alpha-2,8-Sialyltransferase 8A/ST8SIA1/Ganglioside GD3 Antibody (NBP1-80750).
 

Pathways for ST8 alpha-2,8-Sialyltransferase 8A/ST8SIA1/Ganglioside GD3 Antibody (NBP1-80750)

View related products by pathway.

PTMs for ST8 alpha-2,8-Sialyltransferase 8A/ST8SIA1/Ganglioside GD3 Antibody (NBP1-80750)

Learn more about PTMs related to ST8 alpha-2,8-Sialyltransferase 8A/ST8SIA1/Ganglioside GD3 Antibody (NBP1-80750).
 

Research Areas for ST8 alpha-2,8-Sialyltransferase 8A/ST8SIA1/Ganglioside GD3 Antibody (NBP1-80750)

Find related products by research area.

Blogs on ST8 alpha-2,8-Sialyltransferase 8A/ST8SIA1/Ganglioside GD3

There are no specific blogs for ST8 alpha-2,8-Sialyltransferase 8A/ST8SIA1/Ganglioside GD3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ST8 alpha-2,8-Sialyltransferase 8A/ST8SIA1/Ganglioside GD3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ST8SIA1
Entrez