ST3GAL5 Antibody

Images

 
Western Blot: ST3GAL5 Antibody [NBP1-62444] - Titration: 1.25ug/ml Positive Control: Jurkat cell lysate.
Immunohistochemistry-Paraffin: ST3GAL5 Antibody [NBP1-62444] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ST3GAL5 Antibody Summary

Immunogen
Synthetic peptides corresponding to ST3GAL5(ST3 beta-galactoside alpha-2,3-sialyltransferase 5) The peptide sequence was selected from the N terminal of ST3GAL5 (NP_003887). Peptide sequence DSEAESKYDPPFGFRKFSSKVQTLLELLPEHDLPEHLKAKTCRRCVVIGS.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ST3GAL5
Purity
Protein A purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.25 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 4-8 ug/ml
Application Notes
This is a rabbit polyclonal antibody against ST3GAL5 and was validated on Western Blot and immunohistochemistry.
Theoretical MW
48 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Protein A purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ST3GAL5 Antibody

  • 3S-T
  • alpha 2,3-sialyltransferase V
  • CMP-NeuAc:lactosylceramide alpha-2,3-sialyltransferase
  • EC 2.4.99.9
  • Ganglioside GM3 Synthase
  • GM3 synthase
  • lactosylceramide alpha-2,3-sialyltransferase
  • SATI
  • sialyltransferase 9 (CMP-NeuAc:lactosylceramide alpha-2,3-sialyltransferase;GM3 synthase)
  • Sialyltransferase 9
  • Siat9
  • SIATGM3S
  • ST3 beta-galactoside alpha-2,3-sialyltransferase 5
  • ST3Gal V
  • ST3GAL5
  • ST3GALV
  • ST3GalVSIAT9SATI

Background

Ganglioside GM3 is known to participate in the induction of cell differentiation, modulation of cell proliferation, maintenance of fibroblast morphology, signal transduction, and integrin-mediated cell adhesion. ST3GAL5 is a type II membrane protein which catalyzes the formation of GM3 using lactosylceramide as the substrate. It is a member of glycosyltransferase family 29 and may be localized to the Golgi apparatus. Mutation in its gene has been associated with Amish infantile epilepsy syndrome.Ganglioside GM3 is known to participate in the induction of cell differentiation, modulation of cell proliferation, maintenance of fibroblast morphology, signal transduction, and integrin-mediated cell adhesion. The protein encoded by this gene is a type II membrane protein which catalyzes the formation of GM3 using lactosylceramide as the substrate. The encoded protein is a member of glycosyltransferase family 29 and may be localized to the Golgi apparatus.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22203
Species: Hu, Mu, Rt, Mk
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
H00007357-M03
Species: Hu
Applications: WB, ELISA
NBP2-12071
Species: Mu
Applications: WB, IHC, IHC-Fr
NBP1-81621
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NB100-410
Species: Hu, Mu
Applications: WB, IP
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
NBP2-48694
Species: Hu
Applications: IHC, IHC-P
NBP2-12793
Species: Hu, Mu
Applications: WB, IP
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
AF5480
Species: Hu
Applications: IHC
NBP1-62444
Species: Hu
Applications: WB, IHC, IHC-P

Publications for ST3GAL5 Antibody (NBP1-62444) (0)

There are no publications for ST3GAL5 Antibody (NBP1-62444).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ST3GAL5 Antibody (NBP1-62444) (0)

There are no reviews for ST3GAL5 Antibody (NBP1-62444). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ST3GAL5 Antibody (NBP1-62444) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ST3GAL5 Products

Bioinformatics Tool for ST3GAL5 Antibody (NBP1-62444)

Discover related pathways, diseases and genes to ST3GAL5 Antibody (NBP1-62444). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ST3GAL5 Antibody (NBP1-62444)

Discover more about diseases related to ST3GAL5 Antibody (NBP1-62444).
 

Pathways for ST3GAL5 Antibody (NBP1-62444)

View related products by pathway.

PTMs for ST3GAL5 Antibody (NBP1-62444)

Learn more about PTMs related to ST3GAL5 Antibody (NBP1-62444).

Blogs on ST3GAL5

There are no specific blogs for ST3GAL5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ST3GAL5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ST3GAL5
Entrez
Uniprot