ST3GAL3 Antibody

Images

 
Immunohistochemistry-Paraffin: ST3GAL3 Antibody [NBP2-13389] - Staining of human liver shows strong cytoplasmic positivity in hepatocytes.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ST3GAL3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: KLHLLQWEEDSNSVVLSFDSAGQTLGSEYDRLGFLLNLDSKLPAELATKY ANFSEGACKPGYASALMTAIF
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (90%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ST3GAL3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ST3GAL3 Protein (NBP2-13389PEP)
Publications
Read Publication using
NBP2-13389 in the following applications:

  • IHC
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ST3GAL3 Antibody

  • alpha 2,3-sialyltransferase III
  • Alpha 2,3-ST 3
  • alpha-2,3-sialyltransferase II
  • Beta-galactoside alpha-2,3-sialyltransferase 3
  • CMP-N-acetylneuraminate-beta-1,4-galactoside alpha-2,3-sialyltransferase
  • EC 2.4.99.6
  • Gal beta-1,3(4) GlcNAc alpha-2,3 sialyltransferase
  • Gal beta-1,3(4)GlcNAc alpha-2,3 sialyltransferase
  • N-acetyllactosaminide alpha-2,3-sialyltransferase
  • Sialyltransferase 6
  • SIAT6sialyltransferase 6 (N-acetyllacosaminide alpha 2,3-sialyltransferase)
  • ST3 beta-galactoside alpha-2,3-sialyltransferase 3
  • ST3Gal III
  • ST3GALII
  • ST3GalIII
  • ST3N

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF5924
Species: Hu
Applications: WB, Simple Western
NB100-1831
Species: Hu, Mu, Rt
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
AF7275
Species: Hu, Mu, Rt
Applications: WB
NBP1-69565
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-55006
Species: Hu
Applications: ICC/IF
AF5316
Species: Hu
Applications: WB
NB500-526
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
MAB64091
Species: Hu
Applications: WB, ICC
NB600-1468
Species: Hu
Applications: WB, IHC-P, S-ELISA
NBP2-20492
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-38252
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NBP2-13389
Species: Hu, Mu
Applications: IHC, IHC-P

Publications for ST3GAL3 Antibody (NBP2-13389)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IHC.


Filter By Application
IHC
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for ST3GAL3 Antibody (NBP2-13389) (0)

There are no reviews for ST3GAL3 Antibody (NBP2-13389). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ST3GAL3 Antibody (NBP2-13389) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ST3GAL3 Products

Bioinformatics Tool for ST3GAL3 Antibody (NBP2-13389)

Discover related pathways, diseases and genes to ST3GAL3 Antibody (NBP2-13389). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ST3GAL3 Antibody (NBP2-13389)

Discover more about diseases related to ST3GAL3 Antibody (NBP2-13389).
 

Pathways for ST3GAL3 Antibody (NBP2-13389)

View related products by pathway.

PTMs for ST3GAL3 Antibody (NBP2-13389)

Learn more about PTMs related to ST3GAL3 Antibody (NBP2-13389).

Blogs on ST3GAL3

There are no specific blogs for ST3GAL3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ST3GAL3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ST3GAL3