Ssu72 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: Ssu72 Antibody [NBP2-57318] - Staining of human cell line SK-MEL-30 shows localization to nucleoplasm & cytosol.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

Ssu72 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MPSSPLRVAVVCSSNQNRSMEAHNILSKRGFSVRSFGTGTHVKLPGPAPDKPNVYDFKTTY
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: SSU72
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  Ssu72 Recombinant Protein Antigen (NBP2-57318PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for Ssu72 Antibody - BSA Free

• CTD phosphatase SSU72
• EC 3.1.3.16
• FLJ13048
• HSPC182
• PNAS-120
• RNA polymerase II subunit A C-terminal domain phosphatase SSU72
• SSU72 RNA polymerase II CTD phosphatase homolog (S. cerevisiae)
• Ssu72 RNA polymerase II CTD phosphatase homolog (yeast)

Background

Ssu72 may be involved in the C-terminal domain of RNA polymerase II dephosphorylation, RNA processing and termination

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: SSU72